ESTScan Details for Unigene SGN-U203466

Score 
515
Direction 
Forward
Predicted Peptide Sequence 
VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFQKVLRYIREGRDSSATLECGGDRIGSKGYFIQPTVFSNVKEDMSIAQDEIFGPVQCVF
KFKDIGEVIKRANNTRYGLAAGVFTKNIDTANTLTRGLRAGTVWINCYDVFDAGIPFGGYKMSGMGREKGIHSLNNYLQVKAVVTPLKNP
AWI
Predicted Coding Sequence 
XXGGTAGAGAAGGCAAAGGCACGTGCAATGAGACGTGTAGTTGGCGATCCCTTCAAGAAAGGTGTTGAACAAGGTCCTCAGATCGACTCG
GAGCAATTTCAGAAGGTTCTGAGGTACATAAGAGAAGGCCGTGACAGCTCTGCTACCCTTGAATGCGGTGGTGATAGAATTGGTTCCAAA
GGCTACTTTATTCAACCCACTGTGTTCTCAAATGTCAAGGAGGACATGTCAATAGCACAGGATGAGATTTTTGGTCCAGTGCAATGTGTC
TTCAAATTCAAGGATATTGGCGAAGTAATAAAGAGGGCAAACAACACTCGCTATGGTCTAGCAGCAGGAGTTTTCACAAAGAACATCGAC
ACAGCAAACACCTTGACCCGAGGACTGAGAGCTGGAACGGTGTGGATTAACTGCTATGATGTATTTGATGCTGGAATTCCTTTTGGAGGG
TACAAGATGAGTGGCATGGGCAGGGAAAAGGGTATTCACAGCCTTAACAACTACTTACAGGTGAAGGCTGTGGTTACTCCATTGAAAAAT
CCTGCATGGATATAG\
Edits in Original Sequence 
(5')XXGGTAGAGAAGGCAAAGGCACGTGCAATGAGACGTGTAGTTGGCGATCCCTTCAAGAAAGGTGTTGAACAAGGTCCTCAGATCGA
CTCGGAGCAATTTCAGAAGGTTCTGAGGTACATAAGAGAAGGCCGTGACAGCTCTGCTACCCTTGAATGCGGTGGTGATAGAATTGGTTC
CAAAGGCTACTTTATTCAACCCACTGTGTTCTCAAATGTCAAGGAGGACATGTCAATAGCACAGGATGAGATTTTTGGTCCAGTGCAATG
TGTCTTCAAATTCAAGGATATTGGCGAAGTAATAAAGAGGGCAAACAACACTCGCTATGGTCTAGCAGCAGGAGTTTTCACAAAGAACAT
CGACACAGCAAACACCTTGACCCGAGGACTGAGAGCTGGAACGGTGTGGATTAACTGCTATGATGTATTTGATGCTGGAATTCCTTTTGG
AGGGTACAAGATGAGTGGCATGGGCAGGGAAAAGGGTATTCACAGCCTTAACAACTACTTACAGGTGAAGGCTGTGGTTACTCCATTGAA
AAATCCTGCATGGATATAG\(3')ATCGTGGCCACCCTGCTTTTAAATCATAATTGTACTCTCTTTTTTTTTTTTTTTTGTAAAATGGGG
CA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan