ESTScan Details for Unigene SGN-U203504

Score 
450
Direction 
Forward
Predicted Peptide Sequence 
QKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFHAQTGADXGGPAYPDGVAKSDGGFDQTVNVKVIMATNRADTLDPALLRPGR
LDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEF
SSDL
Predicted Coding Sequence 
XTCCAGAAGTATTTGGGTGAGGGTCCACGAATGGTTCGTGATGTCTTCCGACTTGCCAAAGAAAATGCGCCTGCAATTATATTTATTGAT
GAGGTAGATGCAATTGCTACTGCTAGGTTCCATGCTCAGACTGGAGCTGATAXGGGAGGTCCAGCGTATCCTGATGGAGTTGCTAAATCA
GATGGAGGATTTGACCAGACCGTGAATGTGAAAGTTATCATGGCAACTAACCGAGCTGATACTTTGGACCCTGCACTTCTGCGTCCTGGA
AGGCTTGACAGGAAGATTGAATTTCCTTTGCCTGATAGGCGTCAAAAGAGGCTAGTTTTTCAGGTCTGCACTGCTAAGATGAACTTAGGT
GACGAGGTTGACTTGGAAGATTATGTCTCTCGCCCTGATAAAATTAGTGCTGCTGAGATTGCAGCTATTTGTCAGGAAGCAGGTATGCAT
GCAGTGCGAAAGAATCGATATGTCATACTCCCCAAGGACTTTGAAAAGGGTTACAGGACCAATGTGAAGAAGCCGGATACGGACTTTGAG
TTCTCCAGTGATTTATAA\
Edits in Original Sequence 
(5')XTCCAGAAGTATTTGGGTGAGGGTCCACGAATGGTTCGTGATGTCTTCCGACTTGCCAAAGAAAATGCGCCTGCAATTATATTTAT
TGATGAGGTAGATGCAATTGCTACTGCTAGGTTCCATGCTCAGACTGGAGCTGATAXGGGAGGTCCAGCGTATCCTGATGGAGTTGCTAA
ATCAGATGGAcGGATTTGACCAGACCGTGAATGTGAAAGTTATCATGGCAACTAACCGAGCTGATACTTTGGACCCTGCACTTCTGCGTC
CTGGAAGGCTTGACAGGAAGATTGAATTTCCTTTGCCTGATAGGCGTCAAAAGAGGCTAGTTTTTCAGGTCTGCACTGCTAAGATGAACT
TAGGTGACGAGGTTGACTTGGAAGATTATGTCTCTCGCCCTGATAAAATTAGTGCTGCTGAGATTGCAGCTATTTGTCAGGAAGCAGGTA
TGCATGCAGTGCGAAAGAATCGATATGTCATACTCCCCAAGGACTTTGAAAAGGGTTACAGGACCAATGTGAAGAAGCCGGATACGGACT
TTGAGTTCTCCAGTGATTTATAA\(3')AAATAGATGATCAAATATTTTCTAGAGATCGACCCACCTCTGAAGGTTTTCTAGATTGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan