ESTScan Details for Unigene SGN-U203544

Score 
291
Direction 
Forward
Predicted Peptide Sequence 
FCDFGPEXTVFDVDGEEXYTGIIASIGNDNPALISCVDDERLEFQDGDLVVFSEVQGMTELNDGKPRKISGARPYSFTLDEDTTNFGRYN
RGGIVTQVKQPKILNFKTLREAITDPGDFL
Predicted Coding Sequence 
XTCTTCTGTGATTTTGGCCCCGAGXTTACAGTTTTTGATGTAGATGGTGAAGAACXCTATACAGGCATTATTGCATCAATTGGTAATGAT
AATCCTGCCCTGATTTCGTGTGTGGATGATGAAAGGCTTGAGTTTCAGGATGGGGACCTAGTTGTGTTCTCAGAAGTACAGGGCATGACA
GAACTTAATGATGGCAAGCCAAGAAAAATTAGTGGTGCAAGACCTTATTCATTTACCCTCGACGAGGACACAACAAACTTTGGCCGCTAC
AACAGAGGTGGTATTGTGACTCAGGTGAAGCAACCCAAAATTTTGAACTTCAAGACATTGAGGGAAGCTATCACAGATCCTGGCGATTTT
CTT\
Edits in Original Sequence 
(5')XTCTTCTGTGATTTTGGCCCCGAGXTTACAGTTTTTGATGTAGATGGTGAAGAACXCTATACAGGCATTATTGCATCAATTGGTAA
TGATAATCCTGCCCTGATTTCGTGTGTGGATGATGAAAGGCTTGAGTTTCAGGATGGGGACCTAGTTGTGTTCTCAGAAGTACAGGGCAT
GACAGAACTTAATGATGGCAAGCCAAGAAAAATTAGTGGTGCAAGACCTTATTCATTTACCCTCGACGAGGACACAACAAACTTTGGCCG
CTACAACAGAGGTGGTATTGTGACTCAGGTGAAGCAACCCAAAATTTTGAACTTCAAGACATTGAGGGAAGCTATCACAGATCCTGGCGA
TTTTCTT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan