ESTScan Details for Unigene SGN-U203632

Score 
183
Direction 
Forward
Predicted Peptide Sequence 
FAAAVPLIRWNLTASAARPNPQGSYHYGKITSPXTLKIVNTRSQVDGKLRFSLNGISHANAETPFKLAEYFGVGEKVFKYDLMPDEPSNT
DKVTVVPNIKNATFRNFVEIIFENHEKTIQSYHLDGYAFFAVAVEPGTWNPEKRKNYNLVDAXKQAHRPSLSKLMDRDNDNSRQLWNVEP
EIRYVGEILLGQQLYISVLSPARSLRDEYIIPDTNPLCGISKVCPCLNHTQHRX
Predicted Coding Sequence 
TTCGCGGCCGCTGTTCCGCTCATCAGGTGGAACCTTACTGCTAGCGCTGCCCGCCCCAACCCTCAAGGATCCTACCACTACGGAAAGATC
ACATCACCCGXCACTTTGAAGATTGTCAACACTAGGAGTCAAGTAGATGGAAAGCTAAGATTTTCCTTGAACGGTATCTCCCACGCTAAT
GCAGAAACTCCATTCAAGCTCGCTGAATACTTTGGAGTCGGCGAAAAGGTCTTCAAGTACGATCTCATGCCTGATGAGCCCTCAAATACT
GACAAGGTGACCGTTGTACCCAATATCAAGAATGCCACCTTCCGTAACTTTGTTGAGATCATCTTCGAGAACCACGAGAAGACCATTCAA
TCCTATCACCTAGACGGTTATGCCTTCTTCGCAGTAGCTGTCGAGCCTGGAACCTGGAATCCTGAGAAGAGAAAGAACTACAACTTGGTT
GACGCAAXTAAGCAGGCACACCGTCCAAGTCTATCCAAACTCATGGACCGCGATAATGACAACTCTAGACAACTCTGGAATGTGGAACCT
GAGATCAGATATGTGGGAGAGATACTACTTGGACAACAGCTCTACATTAGTGTTCTTTCACCAGCTCGTTCCTTGAGGGATGAGTATATC
ATCCCTGACACCAACCCTCTTTGTGGTATTAGTAAGGTATGCCCATGCCTAAACCATACACAGCATAGAGXX\
Edits in Original Sequence 
(5')TTCGCGGCCGCTGTTCCGCTCATCAGGTGGAACCTTACTGCTAGCGCTGCCCGCCCCAACCCTCAAGGATCCTACCACTACGGAAA
GATCACATCACCCGXCACTTTGAAGATTGTCAACACTAGGAGTCAAGTAGATGGAAAGCTAAGATTTTCCTTGAACGGTATCTCCCACGC
TAATGCAGAAACTCCATTCAAGCTCGCTGAATACTTTGGAGTCGGCGAAAAGGTCTTCAAGTACGATCTCATGCCTGATGAGCCCTCAAA
TACTGACAAGGTGACCGTTGTACCCAATATCAAGAATGCCACCTTCCGTAACTTTGTTGAGATCATCTTCGAGAACCACGAGAAGACCAT
TCAATCCTATCACCTAGACGGTTATGCCTTCTTCGCAGTAGCTGTCGAGCCTGGAACCTGGAATCCTGAGAAGAGAAAGAACTACAACTT
GGTTGACGCAAXTAAGCAGGCACACCGTCCAAGTCTATCCAAACTCATGGACCGCGATAATGACAACTCTAGACAACTCTGGAATGTGGA
ACCTGAGATCAGATATGTGGGAGAGATACTACTTaGGACAACAGCTCTACATTAGTGTTCTTTCACCAGCTCGTTCCTTGAGGGATGAGT
ATATCATCCCTGACACCAACCCTCTTTGTGGTATTAGTAAGGTATGCCCATGCCTAAACCATACACAGCATAGAGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan