ESTScan Details for Unigene SGN-U203643

Score 
7
Direction 
Reverse
Predicted Peptide Sequence 
MVGERSFPYPGFFNHTYRRNTIIYNTFCRPTCKTAYSITDTEGKKLYNSSILVASRNVLWLMVAATPLTHNMTTLVIEVSSTGSAALKLA
VKLLLAALVETPTDVTKLHTAHFTDLAPYWYISSMRQLPQFNVLPDXASIAKLTXVTARTLPLVAPRMYISNVWQPPKPTEPSQCLX
Predicted Coding Sequence 
ATGGTAGGTGAAAGGAGTTTTCCCTATCCAGGATTTTTCAACCACACTTACAGACGCAATACCATTATATACAATACCTTTTGTAGGCCA
ACCTGCAAAACTGCTTATTCTATTACAGATACTGAGGGAAAAAAGCTCTATAATAGCTCTATACTTGTAGCAAGTAGAAATGTCCTCTGG
TTGATGGTTGCTGCAACACCTCTGACACATAACATGACAACTTTAGTCATAGAAGTTTCTAGCACTGGCTCAGCTGCTTTAAAATTAGCT
GTTAAACTTTTGCTGGCTGCGCTCGTTGAAACCCCTACCGATGTCACAAAATTGCACACTGCACATTTCACTGATCTTGCCCCATATTGG
TACATCAGCAGCATGCGGCAGTTGCCGCAATTCAATGTGCTACCTGATXTTGCTTCCATAGCTAAGTTGACTGXTGTGACAGCACGAACA
TTGCCACTTGTTGCTCCTCGAATGTACATTAGTAATGTGTGGCAGCCTCCCAAACCAACTGAGCCATCTCAGTGCCTGGAX\
Edits in Original Sequence 
AATACTCTCGAGTTTTTTTTTTTTTTAAAAACAATATT(5')ATGGTAGGTGAAAGGAGTTTTCCCTATCCAGGATTTTTCAACCACACT
TACAGACGCAATACCATTATATACAATACCTTTTGTAGGCCAACCTGCAAAACTGCTTATTCTATTACAGATACgTGAGGGAAAAAAGCT
CTATAATAGCTCTATACTTGTAGCAAGTAGAAATGTCCTCTGGTTGATGGTTGCTGCAACACCTCTGACACATAACATGACAACTTTAGT
CATAGAAGTTTCTAGCACTGGCTCAGCTGCTTTAAAATTAGCTGTTAAACTTTTGCTcGGCTGCGCTCGTTGAAACCCCTACCGATGTCA
CAAAATTGCACACTGCACATTTCACTGATCTTGCCCCATATTGGTACATCAGCAGCATGCGGCAGTTGCCGCAATTCAcATGTGCTACCT
GATXTTGCTTCCATAGCTAAGTTGACTGXTGTGACAGCACGAACATTGCaCACTTGTTGCTCCTCGAATGTACATTAGTAATGTGTGGCA
GCCTCCgCAAACCAACTGAGCCATCTCAGTGCCTGGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan