ESTScan Details for Unigene SGN-U203735

Score 
-33
Direction 
Reverse
Predicted Peptide Sequence 
PIEYLLESCDFDGRSFFVNEHVLIPRPETEILVKKALDIISQYHLKEIGEIGIGSACVSVSLALENPKISIHASDVSLKALEVASKNIER
FNLKERV
Predicted Coding Sequence 
CCCATAGAGTATTTATTAGAAAGCTGTGATTTTGATGGGCGCTCTTTTTTCGTGAATGAGCATGTTTTAATCCCACGGCCTGAAACGGAG
ATTTTGGTCAAAAAAGCCCTTGATATTATTTCTCAATACCATTTAAAAGAGATAGGCGAAATAGGCATAGGGAGCGCTTGCGTGTCTGTT
AGTTTGGCTTTAGAAAACCCCAAAATTTCCATTCATGCGAGCGATGTTTCATTAAAAGCTTTAGAAGTGGCGTCCAAAAATATTGAACGC
TTTAATTTAAAAGAGCGTGTT\
Edits in Original Sequence 
(5')CCCATAGAGTATTTATTAGAAAGCTGTGATTTTGATGGGCGCTCTTTTTTCGTGAATGAGCATGTTTTAATCCCACGGCCTGAAAC
GGAGATTTTGGTCAAAAAAGCCCTTGATATTATTTCTCAATACCATTTAAAAGAGATAGGCGAAATAGGCATAGGGAGCGCTTGCGTGTC
TGTTAGTTTGGCTTTAGAAAACCCCAAAATTTCCATTCATGCGAGCGATGTTTCATTAAAAGCTTTAGAAGTGGCGTCCAAAAATATTGA
ACGCTTTAATTTAAAAGAGCGTGTT\(3')TTTTTAAAAAAAACGCAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan