ESTScan Details for Unigene SGN-U203763

Score 
475
Direction 
Forward
Predicted Peptide Sequence 
RTESLQATPKSEGSSPVTKSNQHNQQVKHAAVARSEHSANEAAEPKQLKSVKENLIQIGKKPTAMQIKGTALPVDAEEIKLPETNSVKNV
XDRVDLCGMSSDNHLKHDLKCHLLGRRHRERHALPVDAEEIKLPETNSAKNVXDRVDLCGMSSDYHSEHDLKCHLLGRRHRERCEELKTC
KQMARTERNPPFASNMPDKLKQEQVKHALAAQKKNTRKKP
Predicted Coding Sequence 
AGGACTGAAAGCTTGCAAGCAACTCCCAAAAGTGAAGGAAGCTCACCTGTTACAAAATCAAATCAGCATAATCAGCAAGTAAAACATGCA
GCCGTAGCACGATCAGAACACAGTGCTAATGAGGCAGCTGAACCCAAACAGCTTAAAAGTGTGAAGGAAAATCTAATCCAGATTGGGAAG
AAACCAACAGCTATGCAGATAAAGGGAACAGCACTTCCAGTGGATGCCGAGGAGATTAAACTCCCAGAAACCAATTCTGTAAAGAATGTT
CAXGACAGAGTGGACTTGTGTGGTATGTCAAGTGATAACCACCTCAAGCATGACTTGAAGTGCCATCTTCTAGGAAGGAGACATAGGGAA
AGGCATGCACTTCCAGTGGATGCCGAGGAGATTAAACTCCCAGAAACCAATTCTGCAAAGAATGTTCAXGACAGAGTGGACTTGTGTGGT
ATGTCAAGTGATTACCACTCAGAGCATGACTTGAAGTGCCATCTTCTAGGAAGGAGACATAGGGAAAGGTGTGAAGAGCTGAAAACTTGC
AAGCAAATGGCCAGAACTGAAAGAAACCCACCTTTTGCTTCAAATATGCCAGACAAGCTTAAGCAGGAACAAGTAAAACATGCACTTGCA
GCACAAAAAAAGAACACTCGTAAAAAACCT\
Edits in Original Sequence 
(5')AGGACTGAAAGCTTGCAAGCAgACTCCCAAAAGTGAAGGAAGCTCACCTGTTACAAAATCAAATCAGCATAATCAGCAAGTAAAAC
ATGCAGCCGTAGCACGATCAGAACACAGTGCTAATGAGGCAGCTGAACCCAAACAGCTTAAAAGTGTGAAGGAAAATCTAATCCAGATTG
GGAAGAAACCAACAGCTATGCAGATAAAGGGAACAGCACTTCCAGTGGATGCCGAGGAGATTAAACTCCCAGAAACCAATTCTGTAAAGA
ATGTTCAXGACAGAGTGGACTTGTGTGGTATGTCAAGTGATAACCACCTCAgAGCATGACTTGAAGTGCCATCTTCTAGGAAGGAGACAT
AGGGAAAGGCATGCACTTCCAGTGGATGCCGAGGAGATTAAACTCCCAGAAACCAATTCTGCAAAGAATGTTCAXGACAGAGTGGACTTG
TGTGGTATGTCAAGTGATTACCACgTCAGAGCATGACTTGAAGTGCCATCTTCTAGGAAGGAGACATAGGGAAAGGTGTGAAGAGCTGAA
AACTTGCAAGCAAATGGCCAGAACTGAAAGAAACCCACCTTTTGCTTCAAATATGCCAGACAAGCTTAAGCAGGAACAAGTAAAACATGC
ACTTGCAGCACAAAAAAAGAACACTCGTAAAAAACCT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan