Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U203785

Score 
246
Direction 
Forward
Predicted Peptide Sequence 
ASSPSWVQHRNPQQHPRRLSEYVRRSLLSSAGSEPGSHNGVTPPRLSSAASQEMGLSGHPGHRSSSSRSAMLLERQLDGAMGVPYSWRAL
AAAGDGRSRLVSDIRNVLDLMRRGEGLRLEDVMILDQSVFFGMGDIHDRHPDMRLDVDNMSYEE
Predicted Coding Sequence 
XCTGCCTCTTCCCCTAGTTGGGTGCAACACCGAAATCCTCAGCAACACCCCCGGAGACTCTCAGAATATGTTCGTAGATCTTTGTTGTCT
TCAGCTGGCAGTGAACCTGGAAGTCACAATGGTGTCACACCACCACGTTTGAGTTCCGCTGCCTCACAGGAGATGGGGCTTTCTGGCCAT
CCTGGGCATCGTTCGTCAAGTTCAAGGTCGGCGATGCTGTTGGAGAGACAACTCGATGGTGCTATGGGAGTTCCTTATTCCTGGAGGGCT
TTGGCTGCTGCTGGTGATGGAAGAAGCAGACTAGTTTCCGACATTCGCAATGTATTGGATCTAATGCGCAGGGGAGAGGGCTTAAGACTC
GAGGATGTTATGATCCTTGATCAGTCGGTGTTCTTTGGGATGGGGGATATTCATGATCGCCATCCCGATATGCGTCTTGATGTTGATAAC
ATGTCCTATGAGGAA\
Edits in Original Sequence 
(5')XCTGCCTCTTCCCCTAGTTGGGTGCAACACCGAAATCCTCAGCAACACCCCCGGAGACTCTCAGAATATGTTCGTAGATCTTTGTT
GTCTTCAGCTGGCAGTGAACCTGGAAGTCACAATGGTGTCACACCACCACGTTTGAGTTCCGCTGCCTCACAGGAGATGGGGCTTTCTGG
CCATCCTGGGCATCGTTCGTCAAGTTCAAGGTCGGCGATGCTGTTGGAGAGACAACTCGATGGTGCTATGGGAGTTCCTTATTCCTGGAG
GGCTTTGGCTGCTGCTGGTGATGGAAGAAGCAGACTAGTTTCCGACATTCGCAATGTATTGGATCTAATGCGCAGGGGAGAGGGCTTAAG
ACTCGAGGATGTTATGATCCTTGATCAGTCGGTGTTCTTTGGGATGGGGGATATTCATGATCGCCATCCCGATATGCGTCTTGATGTTGA
TAACATGTCCTATGAGGAA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan