ESTScan Details for Unigene SGN-U204003

Score 
139
Direction 
Forward
Predicted Peptide Sequence 
EQDGRRRYDLRNRAEVRRLSMEGVKQRPRSPRRVLQQGMGTKVNRDVRRGGSRVHKRHRLTRGDDSDDSLLVDELDQGPPIPWGRGGSRS
GPPWLFGG
Predicted Coding Sequence 
GAACAGGACGGTAGAAGGCGATATGACCTCCGCAATCGAGCTGAGGTACGCAGGCTTTCTATGGAAGGAGTTAAACAAAGGCCAAGGTCT
CCTCGTAGGGTACTTCAGCAAGGGATGGGGACCAAGGTGAACAGAGATGTAAGAAGAGGAGGATCCCGAGTTCATAAACGTCATCGGCTG
ACACGAGGTGATGACTCTGATGATTCTCTTCTTGTAGATGAGCTGGACCAAGGTCCTCCAATTCCTTGGGGTAGAGGTGGGAGCAGATCT
GGACCACCTTGGCTTTTTGGGGGX\
Edits in Original Sequence 
(5')GAACAGGACGGTAGAAGGCGATATGACCTCCGCAATCGAGCTGAGGTACGCAGGCTTTCTATGGAAGGAGTTAAACAAAGGCCAAG
GTCTCCTCGTAGGGTACTTCAGCAAGGGATGGGGACCAAGGTGAACAGAGATGTAAGAAGAGGAGGATCCCGAGTTCATAAACGTCATCG
GCTGACACGAGGTGATGACTCTGATGATTCTCTTCTTGTAGATGAGCTGGACCAAGGTCCTCCAATTCCTTGGGGTAGAGGTGGGAGCAG
ATCTGGACCACCTTGGCTTTTTGGGGGX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan