ESTScan Details for Unigene SGN-U204028

Score 
274
Direction 
Forward
Predicted Peptide Sequence 
MGMGLEHLQSLLRDIQPDFLVGPDELNKAAERKNNAPIKEVKAALVTSNWDIEAAQKDPNNKRDSSSAIKASRLXTAAX
Predicted Coding Sequence 
ATGGGAATGGGCCTAGAACATTTGCAGTCTCTATTACGAGATATTCAGCCAGATTTCCTCGTCGGACCAGATGAACTTAATAAAGCTGCT
GAGAGAAAGAACAATGCTCCAATAAAAGAAGTCAAAGCTGCTCTTGTCACTAGCAATTGGGATATTGAGGCTGCTCAGAAAGACCCTAAC
AACAAGAGGGATAGTTCCTCTGCCATCAAAGCAAGTCGTCTCGAXACTGCTGCTGAX\
Edits in Original Sequence 
CGATCACATTCTACTAATTAGAAGATGGTATTTTATCGTGGTGTAAAACGTCCTATTTCAATCATATACAAGAGTTTAAATAGTTCTATA
TGTTTTGGACACGGCTATTCTACCTTGAGACGTAATGGAAATTCCATTGCCGAGTCTACAGGATATTTCCACAATC
(5')ATGGGAATGG
GCCTAGAACATTTGCAGTCTCTATTACGAGATATTCAGCCgAGATTTCCTCGTCGGACCAGATGAACTTAATAAAGCTGCTGAGAGAAAG
AACAAgTGCTCCAATAAAAGAAGTCAAAGCTGCTCTTGTCACTAGCAATTGGGATATTGAGGCTGCTCAGAAAGACCCTAACAACAAGAG
GGATAGTTCCTCTGCCATCAAAGCAAGTCGTCTCGAXACTGCTGCTGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan