Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U204146

Score 
196
Direction 
Forward
Predicted Peptide Sequence 
MAXLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSLEKSNSKPFDLGGHHIPVVFGKINXAKVDAVVYLVDA
YDKERLAESNKELH
Predicted Coding Sequence 
ATGGCGTTXTTGGCATCTCTAGGTTTATGGCAAAAAGAAGCTAAGATTCTTTTTCTCGGCCTCGATAATGCCGGCAAAACCACTCTTCTT
CACATGCTCAAAGACGAGAGATTAGTTCAGCATCAGCCGACTCAGTATCCGACATCCGAAGAGTTGAGTTTGGAAAAATCAAATTCAAAG
CCCTTTGATTTAGGTGGTCATCACATCCCTGTCGTGTTTGGAAAGATTAATXATGCCAAGGTTGATGCTGTTGTATACCTGGTAGATGCA
TATGACAAAGAGCGCCTTGCTGAGTCCAACAAAGAATTACAT\
Edits in Original Sequence 
AGAGAGAGAGATCTCCCTCCCCATAATCGGAAAAGAAGAATGTTTCTGTTGGATTGGTTCT(5')ATGGCGTTXTTGGCATCTCTAGGTT
TATGGCAAAAAGAAGCTAAGATTCTTTTTCTCGGCCTCGATAATGCCGGCAAAACCACTCTTCTTCACATGCTCAAAGACGAGAGATTAG
TTCAGCATCAGCCGACTCAGTATCCGACATCCGAAGAGTTGAGTaTTGGAAAAATCAAATTCAAAGCCCTTTGATTTAGGTGGTCATCAC
ATCCCTcGTCGTGTTTGGAAAGATTAATXATGCCAAGGTTGATGCTGTTGTATACCTGGTAGATGCATATGACAAAGAGCGCCTTGCTGA
GTCCAACAAAGAATTACAT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan