ESTScan Details for Unigene SGN-U204255

Score 
302
Direction 
Forward
Predicted Peptide Sequence 
FFFTSTPLLAAGQSVASSDFTSGNXVIEMQALEYCGXLEDCVFVGAVIFSFRVSCQVXVEVVALNARMDGNKDEALRCIGIAKEAIASGN
KQKALKFIRIARRLNSDLSVEDLLAACENLESSTPESSSEVRNVENTKNVTSRVKSDEVSDGERNYTEEHVQLIRQIKTKKDYYAILGLE
KGCTVEEIRKSYRKLSLKVHPDKNKAPGSEEAFKKVSKAFKCLSX
Predicted Coding Sequence 
TTTTTTTTTACCTCAACTCCTCTCCTCGCCGCCGGTCAATCGGTCGCCTCTTCCGATTTCACTTCCGGTAACAXGGTGATTGAAATGCAA
GCGCTTGAGTATTGTGGTXCTCTAGAAGATTGTGTATTTGTTGGAGCTGTGATTTTCAGCTTTAGAGTTTCTTGTCAAGTTGXAGTTGAA
GTTGTTGCTTTGAATGCTAGAATGGATGGTAACAAGGATGAGGCTTTAAGATGCATTGGTATTGCCAAGGAGGCAATTGCATCTGGCAAT
AAGCAGAAAGCACTCAAGTTTATCAGAATTGCACGGCGCCTTAACAGTGATCTATCTGTGGAAGATCTTTTGGCTGCTTGTGAAAATCTG
GAGTCGTCGACTCCCGAGTCCTCGAGTGAGGTTAGAAACGTTGAGAATACGAAAAATGTCACAAGTCGTGTCAAGTCTGATGAGGTTTCC
GATGGGGAGAGGAACTATACAGAAGAACATGTTCAGTTGATTAGGCAAATTAAGACTAAGAAGGACTATTATGCGATTCTTGGTCTAGAG
AAGGGTTGTACAGTTGAGGAGATTAGGAAGTCATACAGAAAACTGTCATTGAAGGTTCATCCCGACAAAAATAAGGCTCCAGGATCTGAA
GAGGCGTTTAAGAAAGTATCGAAGGCATTTAAGTGTTTGAGTGAX\
Edits in Original Sequence 
(5')TTTTTTTTTACCTCAACTCCTCTCCTCGCCGtCCGGTCAATCGGTCGCCTCTTCCGATTTCACTTCCGGTAACAXGGTGATTGAAA
TGCAAGCGCTTGAGTATTGTGGTXCTCTAGAAGATTGTGTATTTGTTcGGAGCTGTGATTTTCAGCTTTAGAGTTTCTTGTCAAGTTGXA
GTTGAAGTTGTTGCTTTGAATGCTAGAATGGATGGTAACAAGGATGAGGCTTTAAGATGCATTGGTATTGCCAAGGAGGCAATTGCATCT
GGCAATAAGCAGAAAGCACTCAAGTTTATCAGAATTGCACGGCGCCTTAACAGTGATCTATCTGTGGAAGATCTTTTGGCTGCTTGTGAA
AATCTGGAGTCGTCGACTCCCGAGTCCTCGAGTGAGGTTAGAAACGTTGAGAATACGAAAAATGTCACAAGTCGTGTCAAGTCTGATGAG
GTTTCCGATGGGGAGAGGAACTATACAGAAGAACATGTTCAGTTGATTAGGCAAATTAAGACTAAGAAGGACTATTATGCGATTCTTGGT
CTAGAGAAGGGTTGTACAGTTGAGGAGATTAGGAAGTCATACAGAAAACTGTCATTGAAGGTTCATCCCGACAAAAATAAGGCTCCAGGA
TCTGAAGAGGCGTTTAAGAAAGTATCGAAGGCATTTAAGTGTTTGAGTGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan