Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U204280

Score 
142
Direction 
Forward
Predicted Peptide Sequence 
RVFPCGEIXVSGTIPAAFGNCTDLYALDLSRNKLTGSIPEEIFDLKQLTKLLLLGNSLXERLPRSVARCQSLVRLRLGENQLPADQIPKE
IAQLQNLVSLDLYMNHFSGGLPPETPNITVL
Predicted Coding Sequence 
AGAGTTTTTCCTTGTGGGGAAATTCXGGTTTCAGGAACCATTCCCGCTGCTTTTGGAAACTGTACCGACCTATATGCCCTTGATCTTTCG
AGGAACAAGCTCACCGGATCTATCCCTGAGGAGATATTTGATTTGAAGCAGCTGACCAAATTGTTGCTTCTTGGGAATTCGTTAANTGAA
CGATTGCCTCGAAGTGTCGCGAGATGCCAGTCTCTTGTGAGGTTGAGGCTTGGTGAGAATCAGCTCCCAGCXGACCAGATTCCTAAGGAG
ATCGCTCAACTGCAAAATCTCGTGTCTCTTGATTTGTACATGAACCATTTCTCTGGTGGCTTGCCTCCTGAAACCCCCAACATTACAGTC
CTT\
Edits in Original Sequence 
(5')AGAGTTTTTCCTTGTGGGGAAATTCXGGTTTCAGGAACCATTCCCGCTGCTTTTGGAAACTGTACCGACCTATATGCCCTTGATCT
TTCGAGGAACAAGCTCACCGGATCTATCCCTGAGGAGATATTTGATTTGAAGCAGCTGACCAAATTGTTGCTTCTTGGGAATTCGTTAAN
TGAACGATTGCCTCGAAGTGTCGCGAGATGCCAGTCTCTTGTGAGGTTGAGGCTTGGTGAGAATCAGCTCCCAGCXGACCAGATTCCTAA
GGAGATCGCTCAACTGCAAAATCTCGTGTCTCTTGATTTGTACATGAACCATTTCTCTGGTGGCTTGCCTCCTGAAACCCCCAACATTAC
AGTCCTT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan