ESTScan Details for Unigene SGN-U204340

Score 
401
Direction 
Forward
Predicted Peptide Sequence 
QDQTQLLVVHETQIAIYEASKLECMKQWISPNVAVTDATYSCDSQSIFASFDDGSVSIFTAAALKLRCRVNPAAYLPSNPSSRVYPVVIA
AHPSESNQCAIGLTDGGVYVLEPLESEGKWGTPPPNENGVAPGMSSAATGLDQAIKVVVRSGLSVSHQMLCAIFFGGSCRFSDLGYTSYA
SGEKFGGFSSWKLRQFGKSDSVKEGFKESLNVDNYX
Predicted Coding Sequence 
XATCAAGATCAGACACAATTGTTGGTGGTTCATGAAACACAGATAGCTATATATGAAGCATCAAAGCTTGAATGCATGAAGCAGTGGATT
TCACCAAATGTTGCAGTTACTGATGCGACATACTCGTGTGATAGCCAGTCAATATTTGCAAGTTTTGATGATGGAAGTGTGAGTATCTTT
ACTGCTGCAGCACTCAAACTGAGGTGTCGGGTGAATCCTGCTGCCTATTTGCCTTCTAACCCAAGCTCCAGAGTGTATCCAGTTGTCATT
GCTGCTCATCCATCTGAATCAAATCAATGCGCAATAGGACTTACCGATGGCGGAGTTTATGTGCTTGAGCCTCTAGAGTCTGAAGGTAAA
TGGGGTACACCTCCTCCAAATGAAAATGGTGTTGCCCCTGGCATGAGCTCAGCTGCCACTGGTCTTGATCAAGCXATCAAGGTAGTTGTT
CGCAGTGGGCTCTCTGTTTCCCATCAAATGCTCTGTGCTATATTTTTTGGGGGGAGCTGTAGATTTTCAGATCTAGGATACACCTCTTAC
GCCAGTGGTGAGAAGTTTGGCGGTTTCTCCAGTTGGAAGCTGAGACAGTTTGGAAAATCAGATTCAGTTAAAGAAGGATTCAAAGAAAGT
CTAAATGTTGATAATTATAXX\
Edits in Original Sequence 
(5')XATCAAGATCAGACACAATTGTTGGTGGTTCATGAAACACAGATAGCTATATATGAAGCATCAAAGCTTGAATGCATGAAGCAGTG
GATTTCACCAAATGTTGCAGTTACTGATGCGACATACTCGTGTGATAGCCAGTCAATATTTGCAAGTTTTGATGATGGAAGTGTGAGTAT
CTTTACTGCTGCAGCACTCAAACTGAGGTGTCGGGTGAATCCTGCTGCCTATTTGCCTTCTAACCCAAGCTCCAGAGTGTATCCAGTTGT
CATTGCTGCTCATCCATCTGAATCAAATCAATGCGCAATAGGACTTACCGATGGCGGAGTTTATGTGCTTGAGCCTCTAGAGTCTGAAGG
TAAATGGGGTACACCTCCTCCAAATGAAAATGGTGTTGCCCCTGGCATGAGCTCAGCTGCCACTGGTCTTGATCAAGCXATCAAGGTAGT
TGTTCGCAGTGGGCTCTCTGTTTCCCATCAAATGCTcCTGTGCTATATTTTTTGGGGGGAGCTGTAGATTTTCAGATCTAGGATACACCT
CTTACGCCAGTGGTGAGAAGTTTGGCGGTTTCTCCAGTTGGAAGCTGAGACAGTTTGGAAAATCAgGATTCAGTTAAAGAAGGATTCAAA
GAAAGTCTAAATGTTGATAATTATAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan