Notice: The contact form functionality has been restored. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U204468

Score 
79
Direction 
Forward
Predicted Peptide Sequence 
QSSDSDVEREEECGICMEMNSKIVLPKCNHALCLKCYREWRSRSQSCPFCRDSLKXGKLWRPVGIHGQQRRRGHVNDNKGESEEAIHVYR
QVALDRAGQCLEHYDTHKGRRAMLPLGLNHHTKDQEMGQTRFRNSGGXASSPSDHKNPTESSWRWGRS
Predicted Coding Sequence 
CAGTCTTCTGACTCGGACGTTGAAAGGGAAGAGGAATGTGGAATCTGCATGGAAATGAACAGCAAAATTGTCCTTCCCAAATGCAATCAT
GCCCTGTGCTTGAAATGCTATCGCGAATGGCGTTCGAGGTCACAGTCATGCCCCTTCTGCCGTGATAGCCTTAAAAXGGGTAAACTCTGG
CGACCTGTGGGTATACATGGACAACAAAGACGTCGTGGACATGTCAACGATAACAAGGGAGAATCTGAGGAGGCTATTCATGTTTATAGA
CAAGTTGCCCTTGATCGTGCCGGACAATGTCTTGAACACTACGATACTCATAAAGGTAGACGAGCAATGCTTCCATTGGGATTGAATCAT
CATACTAAGGATCAAGAAATGGGTCAGACTAGATTTAGAAATTCAGGTGGAXTTGCTTCTTCACCTTCTGATCACAAGAACCCGACCGAG
TCATCGTGGCGCTGGGGTCGAAGCTAA\
Edits in Original Sequence 
(5')CAGTCTTCTGACTCGGACGTTGAAAGGGAAGAGGAATGTGGAATCTGCATGGAAATGAACAGCAAAATTGTCCTTCCCAAATGCAA
TCATGCCCTGTGCTTGAAATGCTATCGCGAATGGCGTTCGAGGTCACAGTCATGCCCCTTCTGCCGTGATAGCCTTAAAAXGGGTAAACT
CTGGCGACCTGTGGGTATACATGGACAACAAAGACGTCGTGGACATGTCAACGATAACAAGGGAGAATCTGAGGAGGCTATTCATGTTTA
TAGACAAGTTGCCCTTGATCGTGCCGGACAATGTCtTTGAACACTACGATACTCATAtAAGGTAGACGAGCAATGCTTCCATTGGGATTG
AATCATCATACTAAGGATCAAGAAATGGGTCAGACTAGATTTAGAAATTCAGGTGGAXTTGCTTCTTCACCTTCTGATCACAAGAACCCG
ACCGAGTCATCGTGGCGCTGGGGTCGAAGCTAA\(3')GTTAGATTAGCCAAAAAAAACATGGAGCTTTTTAATTGCATCTCCTAATTTG
TACATGCTTGTAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan