ESTScan Details for Unigene SGN-U204470

Score 
228
Direction 
Reverse
Predicted Peptide Sequence 
AEFRVAFXTLGNSVGTQNERPAIVPAKPVANSAAARIRDFTRMNPPSFFGSKSKKDPEEFLNQVQKVTDIMGVTNSESAELATYQLQDVA
QTWFKXVEVGEAVDAGPIEWEEFVTAFLDKFFPQELREAKVLEFINLRQGNMTVKSGR
Predicted Coding Sequence 
XATGCAGAGTTCAGAGTTGCATTCNCCACTCTTGGTAATTCAGTTGGTACTCAGAATGAGCGGCCAGCTATCGTTCCGGCCAAACCAGTG
GCCAATTCAGCAGCAGCCAGGATTCGGGACTTCACCCGAATGAATCCTCCATCCTTTTTCGGGTCTAAGTCAAAAAAGGATCCTGAGGAG
TTCCTAAACCAGGTTCAGAAGGTTACGGACATCATGGGGGTTACTAATAGTGAGAGTGCTGAGCTAGCTACATATCAGTTGCAGGATGTT
GCTCAAACTTGGTTCAAAXCAGTAGAAGTCGGAGAGGCAGTTGATGCAGGGCCTATTGAGTGGGAGGAATTTGTCACTGCATTCTTAGAT
AAATTCTTTCCCCAAGAGCTGAGGGAAGCTAAGGTGTTAGAATTTATCAACCTCAGGCAGGGCAACATGACAGTGAAAAGCGGCCGX\
Edits in Original Sequence 
(5')XATGCAGAGTTCAGAGTTGCATTCNCCACTCTTGGTAATTCAGTTGGTACTCAGAATGAGCGGCCAGCTATCGTTCCGGCCAAACC
AGTGGCCAATTCAGCAGCAGCCAGGATTCGGGACTTCACCCGAATGAATCCTCCATCCTTTTTCGGGTCTAAGTCAAAAAAGGATCCTGA
GGAGTTCCTAAACCAGGTTCAGAAGGTTACGGACATCATGGGGGTTACTAATAGTGAGAGTGCTGAGCTAGCTACATATCAGTTGCAGGA
TGTTGCTCAAACTTGGTTCAAAXCAGTAGAAGTCGGAGAGGtCAGTTGATGCAGGGCCTATTGAGTGGGAGGAATTTGTCACTGCATTCT
TAGATAAATTCTTTCCCCAAGAGCTGAGGGAAGCTAAGGTGTTAGAATTTATCAACCTCAGGCAGGGCAACATGACAGTGAAAAGCGGCC
GX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan