ESTScan Details for Unigene SGN-U204547

Score 
39
Direction 
Forward
Predicted Peptide Sequence 
SYTTNGGAEDNPFLDIESNRGNQGYFLYPEKGYLHLGTIDILAMVIQKGLQRXVMLQNSLMGGRTDGLDRYRNWRLDVDNMSYEELLELG
DRIGYVSTGLREHEIAQCVRRTRPFFLSTLSLIRTELERPRTICQEEYEAEDEMGKLDC
Predicted Coding Sequence 
XXGTCCTATACGACGAATGGTGGTGCTGAAGACAACCCTTTTCTGGATATAGAAAGTAACCGTGGTAACCAAGGTTACTTTCTATATCCA
GAAAAGGGTTATTTGCATCTAGGCACCATCGACATTCTCGCCATGGTTATTCAGAAGGGCTTGCAGAGAXTTGTGATGCTTCAAAATAGT
CTTATGGGAGGAAGAACAGATGGTCTTGATCGATATCGGAACTGGAGACTTGACGTGGATAACATGTCCTATGAGGAATTGCTGGAACTT
GGTGACAGAATCGGATATGTCAGCACAGGATTGAGAGAACACGAGATAGCACAATGCGTTAGAAGAACCAGACCCTTCTTTTTGAGTACT
TTATCTCTTATTCGCACAGAATTGGAACGGCCGCGCACCATCTGTCAGGAGGAATATGAGGCTGAGGATGAGATGGGGAAGCTGGATTGT
\
Edits in Original Sequence 
(5')XXGTCCTATACGACGAATGGTGaGTGCTGAAGACAACCCTTTTCTGGATATAGAAAGTAACCGTGGTAtACCAAGGTTACTTTCTA
TATCCAGAAAAGGGTTATTTGCATCTAGGCACCATCGACATTCTCGCCATGGTTATTCAGAAGGGCTTGCAGAGAXTTGTGATGCTTCAA
AATAGTCTTATGGGAGGAAGAACAGATGGTCTTGATCGATATCGGAACTGGAGACTTGACGTGGATAACATGTCCTATGAGGAATTGCTG
GAACTTGGTGACAGAATCGGATATGTCAGCACAGGATTGAGAGAACACGAGATAGCACAATGCGTTAGAAGAACCAGACCCTTCTTTTTG
AGTACTTTATCTCTTATTCGCACAGAATTGGAACGGCCGCGCACCATCTGTCAGGAGGAATATGAGGCTGAGGATGAGATGGGGAAGCTG
GATTGT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan