Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U204672

Score 
93
Direction 
Forward
Predicted Peptide Sequence 
KMVHSAYDYSTDHNSPNKIDAIEYTVKLTHLHSDGSLRVYVPESSSTSXNLHRPISPTKGGLLQERYVLERTVNGFSRRQMLAMEVLLSR
ELLLSLSESIAFHRLPNLETLAVITKAKGANVYSWDDKRGVLAFGRREGFVSLDMMDNIGVLVDQNGKLIQDGRVCWSEAPAVVVIQKPY
AIGLLPRHVX
Predicted Coding Sequence 
AAAATGGTGCACAGTGCATACGATTATTCAACTGATCACAATTCCCCAAACAAAATCGACGCAATCGAATATACGGTTAAACTTACTCAT
CTACATTCCGACGGATCACTCCGCGTCTACGTTCCAGAATCATCGTCAACGTCCGNCAATCTCCACCGTCCGATATCACCCACAAAGGGX
GGGCTTTTACAAGAGAGATATGTACTTGAAAGAACTGTTAATGGGTTTTCTAGAAGACAAATGCTGGCTATGGAAGTGCTTTTATCAAGA
GAGCTATTGCTTTCGCTTTCCGAATCGATTGCGTTTCATCGCTTGCCGAATTTGGAGACTTTAGCTGTGATTACCAAGGCCAAAGGAGCC
AATGTGTATTCATGGGATGATAAAAGAGGGGTTTTGGCATTTGGGAGAAGAGAAGGGTTTGTATCTTTAGACATGATGGATAATATTGGT
GTCTTAGTTGACCAAAACGGAAAGTTGATTCAAGATGGGAGGGTTTGTTGGTCAGAGGCTCCTGCAGTTGTTGTTATTCAGAAGCCCTAC
GCTATAGGTCTCTTACCACGACATGTTGXX\
Edits in Original Sequence 
(5')AAAATGGTGCACAGTGCATACGATTATTCAACTGATCACAATTCCCCAAACAAAATCGACGCAATCGAATATACGGTTAAACTTAC
TCATCTACATTCCGACGGATCACTCCGCGTCTACGTTCCAGAATCATCGTCAACGTCCGNCAATCTCCACCGTCCGATATCACCCACAAA
GGGXGGGCTTTTACAAGAGAGATATGTACTTGAAAGAACTGTTAATGGGTTTTCTAGAAGACAAATGCTGGCTATGGAAGTGCTTTTATC
AAGAGAGCTATTGCTTTCGCTTTCCGAATCGATTGCGTTTCATCGCTTGCCGAATTTGGAGACTTTAGCTGTGATTACCAAGGCCAAAGG
AGCCAATGTGTATTCATGGGATGATAAAAGAGGGGTTTTGGCATTTGGGAGAcAGAGAAGGGTTTGTATCTTTAGACATGATGGATAATA
TTGGTGTCTTAGTTGACCAAAACGGAAAGTTGATTCAAGATGGGAGGGTTTGTTGGTCAGAGGCTCCTGCAGTTGTTGTTATTCAGAAGC
CCTACGCTATAGGTCTCTTACCACGACATGTTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan