Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U204757

Score 
285
Direction 
Forward
Predicted Peptide Sequence 
LESLVTLVTKDEILESFHMALTGIIPREFGNLTFLVSVDLKATNSMEICLKKWACLRRLKFLDLSFNNFRGKVPSWFGYLHYLQVLNLRN
NSFTGSIPCSFSNISTLETLNLNFIXIEGQIPKVIGNLRELKLRGNNLIGSIPLSLSNASRLGTLDISYNSLQGNIPEGIDNLHNMTENE
FDGPIHSEIGRLSNLEILDLGTNHFTGII
Predicted Coding Sequence 
TTGGAGTCACTTGTGACTCTTGTCACCAAAGATGAAATTCTTGAATCTTTCCACATGGCTCTTACCGGCATAATTCCACGTGAATTTGGA
AACCTCACATTTCTTGTTTCTGTTGACTTGAAAGCAACAAATTCCATGGAAATTTGCCTCAAGAAATGGGCATGCTTGCGTCGGCTTAAG
TTTCTTGATTTAAGTTTCAACAACTTCAGAGGGAAGGTTCCCTCTTGGTTTGGATACTTACATTATCTTCAAGTTCTAAATCTTAGAAAT
AATAGTTTCACTGGTTCCATCCCTTGTTCATTTTCTAATATATCCACACTTGAGACTTTGAATCTGAATTTCATTXCCATAGAGGGCCAG
ATACCAAAAGTGATTGGAAACCTTAGAGAATTAAAGTTGAGGGGTAACAATCTAATAGGCTCTATTCCTCTATCACTCTCGAATGCCTCA
AGGTTGGGGACTTTAGATATATCTTATAATTCACTACAAGGAAACATCCCAGAAGGAATTGACAATCTTCACAACATGACTGAAAATGAG
TTTGATGGACCAATACATAGTGAAATTGGAAGATTGAGTAACTTGGAGATATTGGATCTCGGAACTAACCATTTTACTGGGATAATT\
Edits in Original Sequence 
(5')TTGGAGTCACTTGTGACTCTTGTCACCAAAGAgTGAAATTCTTGAATCTTTCCACATGGCTCTTACCGGCATAATTCCACGTGAAT
TTGGAAACCTCACATTTCTTGTTTCTGTTGACTTgGAAAGCAACAAATTCCATGGAAATTTGCCTCAAGAAATGGGCATGCTTGCGTCGG
CTTAAGTTTCTTGATTTAAGTTTCAACAACTTCAGAGGGAAGGTTCCCTCTTGGTTTGGATACTTACATTATCTTCAAGTTCTAAATCTT
AGAAATAATAGTTTCACTGGTTCCATCCCTTGTTCATTTTCTAATATATCCACACTTGAGACTTTGAATCTGAATTTCATTXCCATAGAG
GGCCAGATACCAAAAGTGATTGGAAACCTTAGAGAATTAAAGTTGAGGGGTAACAATCTAATAGGCTCTATTCCTCTATCACTCTCGAAT
GCCTCAAGGTTGGGGACTTTAGATATATCTTATAATTCACTACAAGGAAACATCCCAGAAGGAATTGACAATCTTCACAACATGaACTGA
AAATGAGTTTGATGGACCAATACATAGTGAAATTGGAAGATTGAGTAACTTGGAGATATTGGATCTCGGAACTAACCATTTTACTGGGAT
AATT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan