ESTScan Details for Unigene SGN-U204773

Score 
291
Direction 
Forward
Predicted Peptide Sequence 
KELGXVIDVMKSIGITPDLTSYNFMLTGYCFAGNVASAAGVVAKMEEEELGADTRTYDALVLGACRAGKLDAALALLRRMLDDGVAPLYC
THAHIIGAFLRYNYYEQAIEFVRSYAGRDTKLDAENFGILATRLITRSKFVEAKELVKEMSERRLRIGPPLKDFYESHVKSDGLR
Predicted Coding Sequence 
AAGGAGCTTGGCXGTGTGATTGATGTGATGAAATCCATCGGAATTACTCCCGATTTGACATCGTATAATTTTATGCTGACGGGTTATTGT
TTTGCTGGAAATGTTGCATCGGCTGCTGGTGTTGTAGCAAAGATGGAGGAGGAAGAATTGGGCGCGGATACAAGGACATACGATGCATTG
GTTTTAGGTGCGTGTAGAGCAGGGAAATTGGATGCTGCTTTGGCACTGTTGAGGAGGATGTTAGATGACGGAGTTGCGCCATTGTACTGC
ACACACGCTCATATTATAGGAGCTTTTCTGAGGTATAACTATTATGAACAGGCGATCGAGTTTGTTAGGAGCTATGCAGGGAGGGACACA
AAATTGGACGCGGAGAACTTTGGAATATTGGCAACCAGATTGATCACTCGGAGTAAATTTGTAGAAGCTAAGGAATTGGTGAAAGAGATG
AGTGAAAGGAGATTGAGAATAGGTCCACCATTAAAGGATTTCTATGAATCGCACGTTAAATCTGACGGATTGAGATAA\
Edits in Original Sequence 
(5')AAGGAGCTTGGCXGTGTGATTGATGTGATGAAATCCATCGGAATTACTCCCGATTTGACATCGTATAATTTTATGCTGACGGGTTA
TTGTTTTGCTGGAAATGTTGCATCGGCTGCTGGTGTTGTAGCAAAGATGGAGGAGGAAGAATTGGGCGCGGATACAAGGACATACGATGC
ATTGGTTTTAGGTGCGTGTAGAGCAGGGAAATTGGATGCTGCTTTGGCACTGTTGAGGAGGATGTTAGATGACGGAGTTGCGCCATTGTA
CTGCACACACGCTCATATTATAGGAGCTTTTCTGAGGTATAACTATTATGAACAGGCGATCGAGTTTGTTAGGAGCTATGCAGGGAGGGA
CACAAAATTGGACGCGGAGAACTTTGGAATATTGGCAACCAGATTGATCACTCGGAGTAAATTTGTAGAAGCTAAGGAATTGGTGAAAGA
GATGAGTGAAAGGAGATTGAGAATAGGTCCACCATTAAAGGATTTCTATGAATCGCACGTTAAATCTGACGGATTGAGATAA\(3')TTA
CCAAGTTTGAATTGCATGATTTTTGAAATCAAATGCAATATCTGTCTTGTAGTTGTAAAGTATCAAGCTTCTCAATTGGTTGTTGGTAGC
TTGTAGGATCTTTCAGAAGCTAATCTCCACCATTTGATGACTTACTCTGATC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan