ESTScan Details for Unigene SGN-U204830

Score 
109
Direction 
Forward
Predicted Peptide Sequence 
ENDMKPDVVTYTTLMKTLIRVEKFERVPAVYEEMVLSGCIPDRKARAMLRSALRYMKXYIEVVAAASHSNKYDHAEXMIFQYNFQFKLLF
HSCALTFVTIQELHXLTAKLGRLIKDPRSFVSQHTFIYIL
Predicted Coding Sequence 
XXAGAAAATGATATGAAGCCGGATGTTGTTACTTACACCACTCTCATGAAAACCTTGATACGTGTGGAGAAATTCGAAAGGGTTCCAGCT
GTTTATGAAGAAATGGTATTGTCTGGATGCATCCCAGATAGGAAAGCTAGAGCGATGCTACGATCTGCTCTGAGATACATGAAGXTCTAC
ATTGAAGTTGTAGCAGCTGCAAGTCACTCTAACAAATATGACCATGCTGAGXTCATGATTTTTCAGTATAACTTTCAATTTAAGCTGTTG
TTCCACTCTTGTGCATTAACCTTTGTCACAATTCAAGAACTTCATGXTTTGACAGCCAAATTGGGAAGGTTAATAAAAGATCCTAGGTCC
TTTGTGTCCCAGCATACTTTCATCTACATACTT\
Edits in Original Sequence 
(5')XXAGAAAATGATATGAAGCCGGATGTTGTTACTTACACCACTCTCATGAAAACCTTGATACGTGTGGAGAAATTCGAAAGGGTTCC
AGCTGTTTATGAAGAAATGGTATTGTCTGGATGCATCCCAGATAGGAAAGCTAGAGCGATGCTACGATCTGCTCTGAGATACATGAAGXT
CTACATTGAAGTTGTAGCAGaCTGCAAGTCACTCTAACAAATATGACCATGCTGAGXTCATGATTTTTCAGTATAACTTTCAATTTAAGC
TGTTGTTCCACTCTTGTGCATTAACCTTTGTCACAATTCAAGAACTTCATGXTTTGACAGCCAAATTGGGAAGGTTAATAAAAGATCCTA
GGTCCTTTGTGTCCCAGCATACTTTCATCTACATACTT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan