ESTScan Details for Unigene SGN-U204984

Score 
411
Direction 
Forward
Predicted Peptide Sequence 
PRAAXEHMGXGTPGGLNRQLPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPLTKCKLRILKLERIKDYLLMEEEFV
ANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEIIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDP
MVSVMKVEKAPLESYSDIGGLDTX
Predicted Coding Sequence 
XXCCCCCGGGCTGCAGXGGAACATATGGGTANGGGAACCCCCGGTGGGCTTAACCGTCAACTACCCGGAGATCGGAAGAATGACGGAGAC
AAGAAGGAGAAAAAGTTCGAGCCTGCTGCTCCACCGGCTCGAGTCGGCCGTAAGCAGCGGAAACAGAAGGGTCCCGAAGCAGCAGCTCGG
CTCCCCACTGTTACACCGCTGACCAAGTGCAAGCTTCGGATTTTAAAGCTCGAGCGGATCAAAGATTACCTTTTAATGGAAGAAGAATTC
GTGGCTAATCAGGAAAGGCTGAAGCCTCAGGAAGAGAAAACTGAAGAGGATAGATCTAAGGTTGATGATCTACGTGGTTCGCCGATGAGC
GTGGGAAACCTAGAGGAGATTATTGATGAGAACCATGCCATCGTTTCTTCTTCAGTTGGGCCAGAGTATTATGTTGGGATTTTGTCCTTT
GTGGATAAGGACCAATTGGAACCTGGTTGTGCTATTTTGATGCATAATAAGGTTCTATCGGTTGTGGGGCTTCTTCAAGACGACGTTGAT
CCAATGGTGTCTGTCATGAAGGTTGAGAAAGCTCCTTTGGAATCCTATTCCGATATAGGTGGATTGGACACTCXX\
Edits in Original Sequence 
(5')XXCCCCCGGGCTGCAGXGGAACATATGGGTANGGGAACCCCCGGTGGGCTTAACCGTCAACTACCCGGAGATCGGAAGAATGACGG
AGACAAGAAGGAGAAAAAGTTCGAGCCTGCTGCTCCACCGGCTCGAGTCGGCCGTAAGCAGCGGAAACAGAAGGGTCCCGAAGCAGCAGC
TCGGCTCCCCACTGTTACACCGCTGACCAAGTGCAAGCTTCGGATTTTAAAGCTCGAGCGGATCAAAGATTACCTTTTAATGGAAGAAGA
ATTCGTGGCTAATCAGGAAAGGCTGAAGCCTCAGGAAGAGAAAACTGAAGAGGATAGATCTAAGGTTGATGATCTACGTGGTTCGCCGAT
GAGCGTGGGAAACCTAGAGGAGATTATTGATGAGAACCATGCCATCGTTTCTTCTTCAGTTGGGCCAGAGTATTATGTTGGGATTTTGTC
CTTTGTGGATAAGGACCAATTGGAACCTGGTTGTGCTATTTTGATGCATAATAAGGTTCTATCGGTTGTGGGGCTTCTTCAAGACGACGT
TGATCCAATGGTGTCTGTCATGAAGGTTGAGAAAGCTCCTTTGGAATCCTATTCCGATATAGGTGGATTGGACACTCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan