ESTScan Details for Unigene SGN-U204994

Score 
380
Direction 
Forward
Predicted Peptide Sequence 
LQVLIXISSSTISEKYTCDFRLAGVWNVSFLGYPARAILPYSQALEKLAPHIQQVSMESNGKGVSIDGVPLPYQTGEIDFGEPGTNGQHS
FYQLIHQGRVIPCDFIGVVKSQQPIYLKDEVVSNHDELMSNFFAQPDALAYGKTPEQLQKENVPEHLVSHKTFSGNRPSLSILLPSLNLI
TLDSYWPSMSTELQSKA
Predicted Coding Sequence 
XGGGNGCTTCAAGTGTTGATCNGCATTTCTTCTAGCACCATTTCAGAAAAATATACCTGTGATTTTAGGCTTGCTGGTGTGTGGAATGTT
TCATTTCTTGGATATCCAGCAAGAGCAATATTACCCTATTCTCAAGCATTGGAGAAGTTGGCACCTCATATTCAACAGGTCAGTATGGAG
AGTAATGGGAAAGGGGTGTCTATTGATGGTGTCCCTCTTCCTTACCAGACCGGTGAAATTGATTTTGGTGAACCAGGGACGAATGGCCAA
CACAGCTTTTACCAATTAATTCACCAGGGTCGTGTTATTCCTTGTGATTTTATTGGTGTTGTTAAGAGTCAGCAACCTATTTACCTGAAA
GATGAAGTGGTGAGTAACCATGATGAGCTCATGTCGAACTTCTTTGCGCAGCCAGATGCCCTTGCTTATGGGAAGACACCAGAGCAGTTG
CAAAAGGAGAATGTTCCTGAGCATCTTGTTTCTCATAAGACATTTTCTGGAAATCGACCTTCTCTAAGTATACTACTTCCATCATTGAAT
CTTATAACATTGGACAGTTACTGGCCATCTATGAGCACAGAGTTGCAGTCCAAGGCT\
Edits in Original Sequence 
(5')XGGGNGCTTCAAGTGTTGATCNGCATTTCTTCTAGCACCATTTCAGAAAAATATACCTGTGATTTTAGGCTTGCTGaGTGTGTGGA
ATGTTTCATTTCTTGGATATCCAGCAAGAGCAATATTACCCTATTCTCAAGCATTGGAGAAGTTGGCACCTCATATTCAACAGGTCAGTA
TGGAGAGTAATGGGAAAGGGGTGTCTATTGATGGTGTCCCTCTTCCTTACCAGACCGGTGAAATTGATTTTGGTGAACCAGGGACGAATG
GCCAACACAGCTTTTACCAATTAATTCACCAGGGTCGTGTTATTCCTTGTGATTTTATTGGTGTTGTTAAGAGTCAGCAACCTATTTACC
TGAAAGATGAAGTGGTGAGTAACCATGATGAGCTCATGTCGAACTTCTTTGCGCAGCCAGATGCCCTTGCTTATGGGAAGACACCAGAGC
AGTTGCAAAAGGAGAATGTTCCTGAGCATCTTGTTTCTCATAAGACATTTTCTGGAAATCGACCTTCTCTAAGTATACTACTTCCATCAT
TGAAtTCTTATAACATTGGACAGTTACTGGCCATCTATGAGCACAGAGTTGCAGTCCAAGGCT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan