ESTScan Details for Unigene SGN-U205144

Score 
141
Direction 
Forward
Predicted Peptide Sequence 
IPIHSNKSXVTPYNLYYAFIDLRKTTRLVLDKRTPESHAWGSSLDNHPPCDSPNVESIPVIDLNDEKFVMDKIGHACKTWGAFQIRNHNX
ISKITQRYGIGSEKTIFPSDAAKIKGRSIPDGIGGYGVARISSFFSKLMWSEGFTIFGSPVNMPANFGPHDYNEFCDVIAEYENXDGKVG
RKTDVSNAWVTWNNKX
Predicted Coding Sequence 
XCAATTCCTATCCATTCCAATAAGTCCTAAGTCACACCTTATAATCTCTACTATGCCTTCATTGATCTCAGAAAAACAACTCGACTTGTA
CTCGATAAAAGAACTCCCGAATCACATGCATGGGGATCGTCATTAGACAACCACCCTCCATGTGATTCGCCTAATGTAGAATCTATTCCA
GTTATCGATCTAAACGATGAGAAATTTGTCATGGACAAAATAGGACATGCATGCAAAACATGGGGTGCATTCCAAATCAGAAACCATAAC
ATXATCTCAAAGATTACTCAACGATATGGAATCGGCAGCGAAAAAACTATTTTCCCTTCCGATGCAGCAAAAATTAAAGGCCGCTCGATC
CCCGATGGCATCGGGGGCTATGGGGTGGCTCGAATTTCTTCTTTCTTCTCTAAGCTCATGTGGTCCGAAGGGTTCACTATTTTTGGTTCC
CCTGTCAACATGCCAGCCAACTTTGGCCCACATGATTACAATGAATTCTGTGACGTAATTGCGGAATACGAAAATGAXGATGGAAAAGTT
GGCAGGAAGACTGATGTGTCTAATGCTTGGGTCACTTGGAATAACAAAGXX\
Edits in Original Sequence 
(5')XCAATTCCTATCCATTCCAATAAGTCCTAAGTCACACCTTATAATCTCTACTATGCCTTCATTGATCTCAGAAAAACAACTCGACT
TGTACTCGATAAAAGAACTaCCCGAATCACATGCATGGGGATCGTCATTAGACAACCACCCTCCATGTGATTCGCCTAATGTAGAATCTA
TTCCAGTTATCGATCTAAACGATGAGAAATTTGTCATGGACAAAATAGGACATGCATGCAAAACATGGGGTGCATTCCAAATCAGAAACC
ATAACATXATCTCAAAGATTACTCAACGATATGGAATCGGCAGCGAAAAAACTATTTTCCCTTCCGATGCAGCAAAAATTAAAGGCCGCT
CGATCgCCCGATGGCATCGGGGGCTATGGGGTGGCTCGAATTTCTTCTTTCTTCTCTAAGCTCATGTGGTCCGAAGGGTTCACTATTTTT
GGTTCCCCTGTCgAACATGCCAGCCAACTTTGGCCCACATGATTACAATGAATTCTGTGACGTAATTGCGGAATACGAAAATGAXGATGG
AAAAGTTGGCAGGAAGACTGATGTGTCTAATGCTTGGGTCACTTGGAATAACAAAGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan