ESTScan Details for Unigene SGN-U205211

Score 
327
Direction 
Forward
Predicted Peptide Sequence 
LILWYGAHLVNNGVSTFSKVIKVFVVLVVTANSVAETVSLAPEIIRGGEAVGSVFSILDRSTRIDPDDPEGDPVESIRGDIELRHVDFSY
PSRPDVSVFKDLNLRIRAGQSQALVGASGSGKSSVIGLIERFYDPTGGKVMIDGKDIRRLNLKSLRLKIGLVQQEPALFAASIFDNIAYG
KX
Predicted Coding Sequence 
CTGATTCTTTGGTATGGTGCACACCTTGTTAACAATGGGGTCTCGACTTTCTCTAAGGTGATTAAGGTCTTTGTAGTCCTTGTGGTCACA
GCTAATTCAGTTGCTGAAACTGTCAGCCTAGCACCCGAGATTATTAGGGGTGGTGAAGCTGTTGGTTCTGTATTTTCCATTCTTGATCGC
TCTACTAGGATCGATCCTGATGACCCTGAAGGTGATCCAGTCGAATCAATTAGAGGGGATATTGAACTCCGTCATGTTGATTTTTCGTAC
CCTTCACGACCGGATGTCTCTGTGTTCAAGGACCTCAATCTAAGGATTCGTGCTGGCCAAAGCCAAGCTCTTGTGGGGGCAAGTGGCTCG
GGAAAGAGTTCCGTTATAGGCTTAATCGAAAGGTTCTACGATCCAACAGGCGGAAAAGTTATGATCGATGGGAAAGACATAAGGAGATTA
AACTTGAAGTCTCTAAGGCTTAAAATTGGTTTGGTGCAACAAGAGCCAGCTCTGTTTGCAGCTAGCATTTTTGATAATATTGCCTATGGT
AAAGAX\
Edits in Original Sequence 
(5')CTGATTCTTTGGTATGGTGCACACCTTGTTAACAATGGGGTCTCGACTTTCTCTAAGGTGATTAAGGTCTTTGTAGTCCTTGTGGT
CACAGCTAATTCAGTTGCTGAAACTGTCAGCCTAGCACCCGAGATTATTAGGGGTGGTGAAGCTGTTGGTTCTGTATTTTCCATTCTTGA
TCGCTCTACTAGGATCGATCCTGATGACCCTGAAGGTGATCCAGTCGAATCAATTAGAGGGGATATTGAACTCCGTCATGTTGATTTTTC
GTACCCTTCACGACCGGATGTCTCTGTGTTCAAGGACCTCAATCTAAGGATTCGTGCTGGCCAAAGCCAAGCTCTTGTGGGGGCAAGTGG
CTCGGGAAAGAGTTCCGTTATAGGCTTAATCGAAAGGTTCTACGATCCAACAGGCGGAAAAGTTATGATCGATGGGAAAGACATAAGGAG
ATTAAACTTGAAGTCTCTAAGGCTTAAAATTGGTTTGGTGCAACAAGAGCCAGCTCTGTTTGCAGCTAGCATTTTTGATAATATTGCCTA
TGGTAAAGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan