ESTScan Details for Unigene SGN-U205252

Score 
257
Direction 
Forward
Predicted Peptide Sequence 
MEACFVTSKPFSEKLFPLLGSRTSYSTRKRLSVSQFHQLKKIGTPLSVTCCQASSPFSSPSPQDEEKPIVKMDWRSFRARLIAGERPSPV
GRSFLX
Predicted Coding Sequence 
ATGGAAGCTTGCTTTGTCACTTCAAAGCCTTTCTCAGAGAAACTCTTCCCTTTGTTAGGATCAAGAACTTCTTATTCTACAAGAAAAAGG
TTATCTGTTAGTCAGTTTCATCAGCTCAAAAAAATTGGCACTCCTTTGTCAGTTACATGTTGCCAAGCAAGCTCACCATTCTCATCACCT
TCACCTCAAGATGAAGAAAAACCTATTGTTAAAATGGACTGGCGATCATTTCGAGCTAGATTAATTGCCGGAGAACGACCTTCXCCGGTT
GGAAGATCATTCCTCCXX\
Edits in Original Sequence 
GTGATCAGAGATCAGTTTGCATCTGGTGCAACACTTTTTGGCTAATAAACCAAGAAATTCTCAAACCAAT(5')ATGGAAGCTTGCTTTG
TCACTTCAAAGCCTTTCTCAGAGAAACTCTTCCCTTTGTTAGGATCAAGAACTTCTTATTCTACAAGAAAAAGGTTATCTGTTAGTCAGT
TTCATCAGCTCAAAAAAATTGGCACTCCTTTGTCAGTTACATGTTGCCAAGCAAGCTCACCATTCTCATCACCTTCACCTCAAGATGAAG
AAAAACCTATTGTTAAAATGGACTGGCGATCATTTCGAGCTAGATTAATTGCCGGAGAACGACCTTCXCCGGTTGGAAGATCATTCCTCC
XX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan