ESTScan Details for Unigene SGN-U205290

Score 
263
Direction 
Forward
Predicted Peptide Sequence 
CIVRFVKIATVNGGIEGVIKVNYKFSGSERTLSALKSHDEKRHLRLLAGVDLPIGGTGRPDSVGLYYAKIGIGTPSNDYYVQVDTGSDIM
WVNCAGCDQCPRRGYHGLELAFYNQKDSLSGKVVYCGHQFCKDVNGGLVQAAIVTTHVIFVKVMEMEAIVWATXVEDVGQYDLVSGDLQT
NSTN
Predicted Coding Sequence 
XTTTGTATTGTTCGTTTTGTTAAAATTGCAACTGTAAATGGGGGAATTGAAGGTGTAATTAAAGTGAATTACAAATTTTCTGGTTCTGAG
CGGACTCTAAGTGCCCTAAAATCCCATGATGAAAAGCGTCATCTTCGACTTCTCGCCGGCGTCGACCTTCCTATTGGCGGCACCGGCCGT
CCTGATTCCGTCGGGCTTTACTATGCCAAGATTGGGATTGGAACACCATCAAATGATTATTATGTGCAAGTGGATACAGGAAGCGACATA
ATGTGGGTTAACTGCGCTGGATGTGATCAATGCCCCAGAAGAGGATATCATGGTCTGGAGCTAGCATTTTACAACCAAAAGGATTCTCTC
TCTGGTAAAGTAGTTTATTGTGGACACCAGTTCTGCAAGGATGTAAATGGAGGCTTGGTGCAGGCTGCTATAGTAACAACTCATGTTATT
TTCGTGAAAGTTATGGAGATGGAAGCTATAGTATGGGCTACTXTTGTGGAGGATGTTGGTCAGTATGATCTAGTGTCTGGTGATCTCCAA
ACTAACTCAACAAAT\
Edits in Original Sequence 
(5')XTTTGTATTGTTCGTTTTGTTAAAATTGCAACTGTAAATGGGGGAATTGAAGGTGTAATTAAAGTGAATTACAAATTTTCTGGTTC
TGAGCGGACTCTAAGTGCCCTAAAATCCCATGATGAAAAGCGTCATCTTCGACTTCTCGCCGGCGTCGACCTTCCTATTGGCGGCACCGG
CCGTCCTGATTCCGTCGGGCTTTACTATGCCAAGATTGGGATTGGAACACCATCAAATGATTATTATGTGCAAGTGGATACAGGAAGCGA
CATAATGTGGGTTAACTGCGCTGGATGTGATCAATGCCCCAGAAGAGGATATCATGGTCTGGAGCTAGCATTTTACAACCAAAAGGATTC
TCTCTCTGGTAAAGTAGTTTATTGTGGACACCAGTTCTGCAAGGATGTAAATGGAGGCTTGGTGtCAGGCTGCTATAGTAACAACTCATG
TTATTTTCGTGAAAGTTATGGAGATGGAAGCTATAGTATGGGCTACTXTTGTGGAGGATGTTGGTCAGTATGATCTAGTGTCTGGTGATC
TCCAAACTAACTCAACAAAT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan