ESTScan Details for Unigene SGN-U205367

Score 
532
Direction 
Forward
Predicted Peptide Sequence 
MKAESRRQIPFGNDMILSSKRNIDFDKFVYRIGFGVSQIPSDRFNLRPRMFNDMKIWKFLDDREKFVEMKLKHHHDQDNDHQQMKISKFL
EDREKFGEMKLKHHHHHHHDHHHDHDNEDNDHEQWKMWKFLDDREKFGEMKLKHHHHHDDDEDDEDNDHEQKKISKFQLAREMEVILVKE
IKSDDDEAEKDQAYGX
Predicted Coding Sequence 
ATGAAGGCAGAATCACGGCGTCAGATTCCTTTCGGTAATGATATGATACTATCTTCGAAGAGAAACATTGATTTTGATAAATTTGTGTAT
CGTATCGGCTTCGGCGTTAGTCAAATTCCGTCGGATCGGTTCAATTTGCGTCCCCGCATGTTTAATGATATGAAGATCTGGAAGTTTCTA
GATGATCGCGAGAAGTTTGTGGAAATGAAATTGAAGCATCACCATGACCAGGACAATGATCATCAACAGATGAAGATCTCGAAGTTTCTA
GAAGATCGCGAGAAGTTTGGAGAAATGAAATTGAAGCATCACCATCACCATCACCATGACCATCACCATGACCACGACAACGAAGACAAT
GATCATGAACAGTGGAAGATGTGGAAGTTTCTAGATGATCGCGAGAAGTTTGGGGAAATGAAATTGAAGCACCACCATCACCATGACGAT
GACGAGGACGACGAAGACAATGATCATGAACAGAAGAAGATCTCGAAGTTTCAATTGGCGCGTGAAATGGAGGTAATTTTGGTGAAAGAA
ATCAAAAGTGATGATGATGAGGCTGAGAAAGATCAAGCTTATGGAAXX\
Edits in Original Sequence 
GTTAATTTAGTCAGATTCCGGCCGATCAACCGTCGATTTCGGCTCCGATCGAAGCTACCGTTCCGCTTATGTAACCAC(5')ATGAAGGC
AGAATCACGGCGTCAGATTCCTTTCGGTAATGATATGATACTATCTTCGAAGAGAAACATTGATTTTGATAAATTTGTGTATCGTATCGG
CTTCGGCGTTAGTCAAATTCCGTCGGATCGGTTCAATTTGCGTCCCCGCATGTTTAATGATATGAAGATCTGGAAGTTTCTAGATGATCG
CGAGAAGTTTGTGGAAATGAAATTGAAGCATCACCATGACCAGGACAATGATCATCAACAGATGAAGATCTCGAAGTTTCTAGAAGATCG
CGAGAAGTTTGGAGAAATGAAATTGAAGCATCACCATCACCATCACCATGACCATCACCATGACCACGACAACGAAGACAATGATCATGA
ACAGTGGAAGATGTGGAAGTTTCTAGATGATCGCGAGAAGTTTGGGGAAATGAAATTGAAGCACCACCATCACCATGACGATGACGAGGA
CGACGAAGACAATGATCATGAACAGAAGAAGATCTCGAAGTTTCAATTGGCGCGTGAAATGGAGGTAATTTTGGTGAAAtGAAATCAAAA
GTGATGATGATGAGGCTGAGAAAGATCAAGCTTATGGAAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan