ESTScan Details for Unigene SGN-U205377

Score 
143
Direction 
Reverse
Predicted Peptide Sequence 
PGDATAVYASTEKXEKELGWKAKYGINEMCRDQWKWASQNPWGYQSKPWNVK
Predicted Coding Sequence 
XGACCAGGTGATGCCACTGCTGTCTATGCATCAACCGAAAAGNCTGAGAAGGAACTCGGTTGGAAGGCAAAATATGGTATAAATGAGATG
TGCAGGGACCAGTGGAAATGGGCAAGCCAAAACCCTTGGGGTTACCAATCAAAGCCTTGGAATGTTAAATAA\
Edits in Original Sequence 
(5')XGACCAGGTGATGCCACTGCTGTCTATGCATCAACCGAAAAGNCTGAGAAGGAACTCGGTTGGAAGGCAAAATATGGTATAAATGA
GATGTGCAGGGACCAGTGGAAATGGGCAAGCCAAAACCCTTGGGGTTACCAATCAAAGCCTTGGAATGTTAAATAA\(3')TACAAAGTA
TAGCACTTGGGAGGACAAGACTAGAGTCGACATCCTAGTACTTTACATTTTACGCAAACATAAATGTATCCTAAGACTAAATTGTTCAAC
AATTAGCTGCATAATAGCTGTTGATGGTTGTGTACTGGTGAATCCTGTTCTTGTTTTCCCTAATGCTTTAATGATCCCTTCAGCCAAATT
TCTTTACTGATTGTAATTTCATTCGAAAAGAATAAAGGATCTGGTCTATTATGCTACTAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan