ESTScan Details for Unigene SGN-U205384

Score 
112
Direction 
Reverse
Predicted Peptide Sequence 
KERNKSSEFLTLFGDQYVHFNVSIPSNLTPRQRQFIEEFAKEEQGEYDKGAAAGALKVRAQTRGRLGGYRRELKYVLSNILSHELGNLAR
AILGSDHRHSIRFLSTFA
Predicted Coding Sequence 
AAAGAAAGGAATAAAAGCTCGGAATTCCTTACTCTCTTCGGAGATCAGTATGTCCACTTCAATGTCAGCATTCCCTCAAACTTGACACCA
AGACAGCGTCAATTTATTGAGGAGTTCGCCAAGGAAGAGCAAGGGGAATACGATAAAGGGGCTGCAGCAGGAGCXCTCAAGGTGAGGGCA
CAAACACGAGGTAGGTTAGGGGGATATAGGCGCGAGTTAAAGTATGTACTATCAAATATTCTTTCTCATGAGCTGGGAAACTTAGCCAGA
GCAATTTTGGGGAGTGATCATCGCCATTCTATCCGTTTCCTTTCTACATTCGCGTGA\
Edits in Original Sequence 
(5')AAAGAAAGGAATAAAAGCTCGGAATTCCTTACTCTCTTCGGAGATCAGTATGTCCACTTCAATGTCAGCATTCCCTCAAACTTGAC
ACCAAGACAGCGTCAATTTATTGAGGAGTTCGCCAAGGAAGAGCAAGGGGAATACGATAAAGGGGCTGCAGCAGGAGCXCTCAAGGTGAG
GGCACAAtACACGAGGTAGGTTAGGGGGATATAGGCGCGAGTTAAAGTATGTACTATCAAATATTCTTTCTCATGAGCTGGGAAACTTAG
CCAGAGCAATTTTGGGGAGTGATCATCGCCATTCTATCCGTTTCCTTTCTACATTCGCGTGA\(3')GGGTTTAATTGTTGCTTGAAGGA
AGGGACTGGTTGGTTATAGCATCGTTATTGTGACATCAAGATAATGTAGCATTTGATCTGCAACTTAGTGTTGTACATAAATATGAAACA
AATAAATGTTTCTGGAGGACAGTGAAATACTTCCATGACGTTGATCCTCAAATTTAATTTTGAGCGGCCGCGAATTCGCGGCCGCTAGCG
GCCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan