ESTScan Details for Unigene SGN-U205453

Score 
255
Direction 
Forward
Predicted Peptide Sequence 
MSSRDGKKPSRQTSGNRAGGIRTLSDLNRPSRHDSDSDSDGPQEYYTGGEKSGMLVQHPSKHNDVDAIFDRPRQVGATQGPLETGVPSSS
FTGPGRTXAGETVPTSPPHPPEPX
Predicted Coding Sequence 
ATGTCGTCACGCGATGGGAAGAAACCGTCAAGGCAAACGTCCGGCAACCGTGCCGGTGGGATTCGTACACTTTCCGATCTGAATCGTCCA
TCCCGTCACGATTCCGATAGCGACTCCGATGGTCCCCAAGAATACTACACCGGTGGTGAAAAAAGTGGAATGCTTGTTCAACATCCTTCA
AAGCATAATGATGTGGACGCCATCTTTGACCGACCTAGGCAAGTGGGTGCCACGCAAGGTCCTTTGGAAACCGGTGTNCCTAGTTCAAGC
TTTACTGGACCTGGGAGAACTNTTGCAGGGGAGACAGTACCAACATCACCTCCTCACCCGCCTGAGCCCATX\
Edits in Original Sequence 
GCAGAGTAGAGATAATCAATAATCA(5')ATGTCGTCACGCGATGGGAAGAAACCGTCAAGGCAAACGTCCGGCAACCGTGCCGGTGGGA
TTCGTACACTTTCCGATCTGAATCGTCCATCCCGTCACGATTCCGATAGCGACTCCGATGGTCCCCAAGAATACTACACCGGTGGTGAAA
AAAGTGGAATGCTTGTTCAACATCCTTCAAAGCATAATGATGTGGACGCCATCTTTGACCGACCTAGGCAAGTGGGTGCCACGCAAGGTC
CTTTGGAAACCGGTGTNCCTAGTTCAAGCTTTACTGGACCTGGGAGAACTNTTGCAGGGGAGACAGTACCAACATCACCTCCTCACCCGC
CTGAGCCCATX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan