ESTScan Details for Unigene SGN-U205557

Score 
301
Direction 
Forward
Predicted Peptide Sequence 
MAFHVFFFFTLLFMANNPPELLAIPVLPEPDPEELHSQTFLPSPAPPATIPAFPEQSNVAGCPLDLPEELFHSXKISLGVPQLFGSSTPD
PLLPLLAAWLYSAYSKTALHRARSKLPQWTTTTSVDMPVLPDDSETCVDXLEKALGNRGIELVKPNGTCDVVYCYWGIRLHPLTCPQPFS
GDSKGKLAGDKSGKKLERDCLTINGYTGLA
Predicted Coding Sequence 
ATGGCTTTCCACGTTTTCTTCTTCTTCACTCTACTTTTCATGGCTAATAACCCACCCGAACTACTCGCCATTCCGGTTTTACCCGAACCC
GACCCGGAAGAACTCCATTCCCAAACTTTCCTCCCTTCCCCTGCACCTCCGGCGACAATTCCCGCTTTCCCGGAGCAGTCAAACGTCGCC
GGTTGTCCATTGGATCTACCGGAAGAACTCTTCCACAGCXGTAAAATCAGCTTGGGGGTCCCACAGTTATTCGGGTCAAGTACACCAGAC
CCGTTGTTGCCCCTTTTAGCAGCTTGGCTCTACTCAGCTTACTCTAAAACTGCGTTACACAGAGCCCGCAGCAAACTCCCACAGTGGACT
ACTACTACTTCCGTTGATATGCCGGTGCTTCCTGATGATTCGGAGACGTGTGTGGATTNCCTGGAAAAGGCGTTGGGTAACAGAGGGATT
GAGTTGGTGAAGCCGAATGGGACGTGTGATGTTGTTTATTGTTATTGGGGAATTAGGCTTCATCCACTTACTTGTCCACAACCATTTTCT
GGGGATTCAAAAGGGAAATTGGCTGGGGATAAAAGTGGGAAAAAACTGGAAAGAGATTGTTTGACTATCAACGGGTATACTGGTCTTGCT
\
Edits in Original Sequence 
(5')ATGGCTTTCCACGTTTTCTTCTTCTTCACTCTACTTTTCATGGCTAATAACCCACCCGAACTACTCGCCATTCCGGTTTTACCCGA
ACCCGACCCGGAAGAACTCCATTCCCAAACTTTCCTCCCTTCCCCTGCACCTCCGGCGACAATTCCCGCTTTCCCGGAGCAGTCAAACGT
CGCCGGTTGTCCATTGGATCTACCGGAAGAACTCTTCCACAGCXGTAAAATCAGCTTGGGGGTCCCACAGTTATTCGGGTCAAGTACACC
AGACCCGTTGTTGCCCCgTTTTAGCAGCTTGGCTCTACTCAGCTTACTCTAAAACTGCGTTACACAGAGCCCGCAGCAAACTCCCACAGT
GGACTACTACTACTTCCGTTGATATGCCGGTGCTTCCTGATGATTCGGAGACGTGTGTGGATTNCCTGGAAAAGGCGTTGGGTAACAGAG
GGATTGAGTTGGTGAAGCCGAATGGGACGTGTGATGTTGTTTATTGTTATTGGGGAATTAGGCTTCATCCACTTACTTGTCCACAACCAT
TTTCTGGGGATTCAAAAGGGAAATTGGCTGGGGATAAAAGTGGGAAAAAACTGGAAAGAGATTGTTTGACTATCAACGGGTATACTGGTC
TTGCT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan