ESTScan Details for Unigene SGN-U205562

Score 
428
Direction 
Forward
Predicted Peptide Sequence 
MAKIVSILLLALLAISMLATTVLAANGKHHHAKKYGPGKLEALAMSATMYKEVYQNTVPQPMHVXPAKSAATTACVFHLLPMETRLFVHV
TTTGRPRQGGPX
Predicted Coding Sequence 
ATGGCCAAGATAGTTTCAATTCTCCTTTTGGCCCTCCTTGCCATCTCCATGCTTGCTACCACTGTTCTGGCTGCAAATGGCAAGCACCAC
CATGCTAAAAAGTATGGACCXGGGAAGCTTGAAGCCCTCGCAATGTCTGCCACAATGTACAAGGAGGTGTACCAAAACACAGTACCACAA
CCCATGCATGTTXCTCCTGCCAAAAGTGCTGCAACAACTGCTTGTGTGTTCCACCTGCTACCTATGGAAACAAGGCTGTTTGTCCATGTT
ACAACAACTGGAAGACCAAGGCAAGGAGGACCCAAX\
Edits in Original Sequence 
ACTAAACTCACAAATTTGGCCTTCCAATATACTCCTGTTTCTCTCTTCTAGACGTGAATAGGCTTACTTGCTCCCCCATTTCCACTAAGA
AAATCAGCC
(5')ATGGCCAAGATAGTTTCAATTCTCCTTTTGGCCCTCCTTGCCATCTCCATGCTTGCTACCACTGTTCTGGCTGCAAA
TGGCAAGCACCACCATGCTAAAAAGTATGGACCXGGGAAGCTTGAAGCCCTCGCAATGTCTGCCACAATGTACAAGGAGGTGTACCAAAA
CACAGTACCACAACCCATGCATGTTXCTCCTGCCAAAAGTGCTGCAACAACTGCTTGTGTGTTCCACCTGCTACCTATGGAAACAAGGCT
GTTTGTCCATGTTACAACAACTGGAAGACCAAGGCAAGGAGGACCCAAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan