ESTScan Details for Unigene SGN-U205680

Score 
426
Direction 
Forward
Predicted Peptide Sequence 
GSQGGGGHFRSHQQIQTLNLDNQPCLXKQGGKAKPLKAPKADKKEYDENDKAFLAKKKEEEKALKELKAKAQKGSIGGTGLKKSGKK
Predicted Coding Sequence 
XXTGGATCCCAAGGTGGAGGAGGGCATTTCCGTTCTCATCAACAGATCCAAACTCTTAACCTAGATAATCAACCATGTCTTXCTAAGCAA
GGTGGAAAGGCAAAGCCTTTGAAGGCACCAAAGGCTGATAAGAAGGAGTACGATGAGAATGACAAGGCCTTTCTTGCAAAGAAGAAAGAA
GAAGAAAAGGCCCTAAAGGAGCTCAAGGCAAAGGCTCAGAAAGGGTCCATTGGTGGTACCGGCCTGAAAAAGAGCGGAAAGAAGTGA\
Edits in Original Sequence 
(5')XXTGGATCCCAAGGTGGAGGAGGGCATTTCCGTTCTCATCAACAGATCCAAACTCTTAACCTAGATAATCAACCATGTCTTXCTAA
GCAAGGTGGAAAGGCAAAGCCTTTGAAGGCACCAAAGGCTGATAAGAAGGAGTACGATGAGAATGACAAGGCCTTTCTTGCAAAGAAGAA
AGAAGAAGAAAAGGCCCTAAAGGAGCTCAAGGCAAAGGCTCAGAAAGGGTCCATTGGTGGTACCGGCCTGAAAAAGAGCGGAAAGAAGTG
A\(3')GGATGTTGTTATATTCTCCTAGTATTGAAAAAATCTCGTCCTACCCATGGCTAGATTTGGTGTTCTAAGTTCAAATAGTTAAGT
TTTTGTGAACTTTTGGATGTTACTATGGTGATTGAATGAATTAGGATGGGGCACTTGCTCCTTTCCAATATATGATGACATGTATTGTGG
TGCCTTTGCCTATCAATAATTCATGTTGGCATTAATATTTGTGCGAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan