ESTScan Details for Unigene SGN-U205684

Score 
619
Direction 
Forward
Predicted Peptide Sequence 
CAILVIFLHQWHYXGKTIGSGTAKKATSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRI
VPRHIQLAVRNDEELSKLLGDVTIANGGVMPNIHNLLLPKKTGGSSKAADED
Predicted Coding Sequence 
XTCTGTGCAATTCTAGTGATTTTTCTCCATCAATGGCATTATGAXGGCAAAACTATAGGTTCAGGAACTGCAAAGAAGGCTACTTCTCGT
AGTAGCAAAGCTGGTCTGCAGTTTCCGGTGGGTCGTATAGCTAGGTTTCTGAAGGCTGGAAAGTATGCTGAGCGTGTCGGTGCCGGTGCT
CCGGTTTACCTTGCTGCCGTTCTGGAGTACCTTGCTGCCGAGGTTCTTGAACTAGCTGGAAATGCAGCAAGGGACAACAAAAAGACTAGG
ATTGTGCCAAGGCACATTCAGTTGGCTGTGAGGAACGACGAGGAGCTGAGCAAGCTTCTTGGAGATGTAACCATTGCTAATGGTGGTGTG
ATGCCCAACATTCACAACCTTCTTCTTCCAAAGAAAACTGGTGGTTCATCAAAGGCTGCTGATGAAGATTGA\
Edits in Original Sequence 
(5')XTCTGTGCAATTCTAGTGATTTTTCTCCATCAATGGCATTATGAXGGCAAAACTATAGGTTCAGGAACTGCAAAGAAGGCTACTTC
TCGTAGTAGCAAAGCTGGTCTGCAGTTTCCGGTGGGTCGTATAGCTAGGTTTCTGAAGGCTGGAAAGTATGCTGAGCGTGTCGGTGCCGG
TGCTCCGGTTTACCTTGCTGCCGTTCTGGAGTACCTTGCTGCCGAGGTTCTTGAACTAGCTGGAAATGCAGCAAGGGACAACAAAAAGAC
TAGGATTGTGCCAAGGCACATTCAGTTGGCTGTGAGGAACGACGAGGAGCTGAGCAAGCTTCTTGGAGATGTAACCATTGCTAATGGTGG
TGTGATGCCCAACATTCACAACCTTCTTCTTCCAAAGAAAACTGGTGGTTCATCAAAGGCTGCTGATGAAGATTGA\(3')ACAATCCAA
GACTTGAGACTTGGTTTTTTTAGTTAGCTGTGTTTGTTCTTATTTTGGAATAGTACTTTAAGGACTTTCTAGTGTTTTTACTTAGTTGTT
TAGTAGGTTGGTGGGGGTTATGGTTGCTTGTGTATACAAATGATTAAGCAAATCAATGAAAGACCAATGTTTATTTTCTTAAAAAAAAAA
AAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan