ESTScan Details for Unigene SGN-U205718

Score 
305
Direction 
Reverse
Predicted Peptide Sequence 
VDPKKNLDSWKLVCEVKAHEMAVLCMCLMMGEFLCSGSADKSICIWKREINGGLFKFGVIKGHEGPVKCLQASPASVGGGFMLYSGSLDK
TLRVWWIPKYEKKDSSLTLN
Predicted Coding Sequence 
GTGGATCCAAAGAAGAATCTTGATAGTTGGAAACTGGTTTGTGAAGTGAAAGCACATGAAATGGCTGTTTTGTGTATGTGTTTGATGATG
GGTGAATTCTTGTGTAGTGGATCAGCTGATAAGAGTATTTGTATATGGAAAAGGGAAATCAATGGAGGGTTGTTTAAATTTGGTGTTATT
AAAGGACATGAAGGACCTGTTAAGTGTTTACAAGCTTCACCAGCTAGTGTAGGGGGTGGGTTCATGTTGTATAGTGGAAGTCTTGATAAA
ACTCTTAGAGTTTGGTGGATTCCAAAGTATGAGAAAAAGGACTCATCTTTGACATTAAACTGA\
Edits in Original Sequence 
(5')GTGGATCCAAAGAAGAATCTTGATAGTTGGAAACTGGTTTGTGAAGTGAAAGCACATGAAATGGCTGTTTTGTGTATGTGTTTGAT
GATGGGTGAATTCTTGTGTAGTGGATCAGCTGATAAGAGTATTTGTATATGGAAAAGGGAAATCAATGGAGGGTTGTTTAAATTTGGTGT
TATTAAAGGACATGAAGGACCTGTTAAGTGTTTACAAGCTTCACCAGCTAGTGTAGGGGGTGGGTTCATGTTGTATAGTGGAAGTCTTGA
TAAAACTCTTAGAGTTTGGTGGATTCCAAAGTATGAGAAAAAGGACTCATCTTTGACATTAAACTGA\(3')AAATTTTCTCAACTTGAA
GATGCACTGTTTGACTCTTTGTTTTTGTTTTTACAGTGTGGACAGTGCTTCTAGTTGTTTTTGTGAGTTTATACAAAAGGGTTTGTTAGG
ATTTTAGTAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan