ESTScan Details for Unigene SGN-U205805

Score 
75
Direction 
Reverse
Predicted Peptide Sequence 
VLRFYQGVRTPVSVVLVNGPPISGVDRTMALQLPDKCSANFEQCEFSK
Predicted Coding Sequence 
XGCGTGTTGCGCTTCTATCAAGGCGTTAGGACACCCGTGTCTGTTGTTCTTGTCAATGGCCCTCCCATTTCTGGGGTTGATCGAACCATG
GCCTTACAGCTTCCTGATAAGTGCAGTGCCAACTTTGAACAATGTGAATTTTCTAAGTAG\
Edits in Original Sequence 
(5')XGCGTGTTGCGCTTCTATCAAGGCGTTAGGACACCCGTGTCTGTgTGTTCTTGTCAATGGCCCTCCCATTTCTGGGGTTGATCGAA
CCATGGCCTTACAGCTTCCTGATAAGTGCAGTGCCAACTTTGAACAATGTGAATTTTCTAAGTAG\(3')GAATACTAGATTGGATTCTG
GTAGGTGTGGTGAAGGAAGAAATCTAGAATAAATATGTGCAGGAGAGCTATAGGCTTAGGACTGCTACTCTGAACAAGTAAATTATGAAA
ATTTGAAATATGAACTAAATCGAATTAAGTGTTCACTTAGTTTATTTAGCTCTTCTTAATATCTTTCTTATGGTAATAATGTTTAACATA
AATACTTATGTAATGCAAAATGGTCGCTTGACCGCTTTTATTTTGACATAATATATGTTTGTTGGCTTGTGTTTCAAAAAAAAAAAAAAA
AAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan