ESTScan Details for Unigene SGN-U205890

Score 
172
Direction 
Forward
Predicted Peptide Sequence 
GETEKFVERERGELQVLEMAGRVDLDGNPIKPITICMIGAGGFIGSHLCEKLMSETPHKVLAVDVYSDKIKHLLEPATSTWADRIQFHRI
NIKNDSRLEGLIKMADLTINLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSENGKRLIHFSTCEVYGKTTGAFLPKDSPLRQDPAYYV
X
Predicted Coding Sequence 
GGAGAAACTGAAAAATTTGTAGAGAGAGAGAGAGGGGAATTGCAGGTTTTGGAAATGGCCGGAAGAGTAGATCTGGACGGTAATCCCATA
AAGCCGATTACAATATGCATGATCGGTGCCGGTGGATTTATCGGTTCTCATTTATGTGAAAAGCTCATGTCGGAAACTCCTCATAAAGTA
CTCGCCGTCGATGTTTATAGTGATAAGATTAAGCATTTGCTTGAACCAGCGACTTCTACCTGGGCTGATCGAATTCAGTTTCATCGAATT
AATATTAAGAATGATTCTCGCCTTGAAGGTCTCATCAAAATGGCAGATCTGACCATAAATCTTGCTGCGATCTGCACACCAGCAGATTAC
AACACTCGTCCACTTGATACAATTTACAGCAATTTCATCGATGCTCTACCAGTGGTCAAGTACTGCTCAGAAAATGGAAAGCGACTCATT
CACTTCTCAACTTGTGAAGTTTATGGGAAAACAACAGGTGCATTTTTACCCAAAGACAGTCCACTGCGGCAGGATCCTGCTTATTATGTG
CXX\
Edits in Original Sequence 
(5')GGAGAAACTGAAAAATTTGTAGAGAGAGAGAGAGGGGAATTGCAGGTTTTGGAAATGGCCGGAAGAGTAGATCTGGACGGTAATCC
CATAAAGCCGATTACAATATGCATGATCGGTGCCGGTGGATTTATCGGTTCTCATTTATGTGAAAAGCTCATGTCGGAAACTCCTCATAA
AGTACTCGCCGTCGATGTTTATAGTGATAAGATTAAGCATTTGCTTGAACCAGCGACTTCTACCTGGGCTGATCGAATTCAGTTTCATCG
AATTAATATTAAGAATGATTCTCGCCTTGAAGGTCTCATCAAAATGGCAGATCTGACCATAAATCTTGCTGCGATCTGCACACCAGCAGA
TTACAACACTCGTCCACTTGATACAATTTACAGCAATTTCATCGATGCTCTACCAGTGGTCAAGTACTGCTCAGAAAATGGAAAGCGACT
CATTCACTTCTCAACTTGTGAAGTTTATGGGAAAACAACAGGTGCATTTTTACCCAAAGACAGTCCACTGCGGCAGGATCCTGCTTATTA
TGTGCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan