ESTScan Details for Unigene SGN-U205981

Score 
453
Direction 
Reverse
Predicted Peptide Sequence 
AGGPLGEVVDPIYPGGSFDPLGLADDPEAFSELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Predicted Coding Sequence 
XTTGCTGGTGGGCCTCTTGGTGAGGTTGTCGACCCAATATACCCCGGTGGCAGCTTTGACCCATTAGGTCTTGCTGATGATCCAGAGGCA
TTTTCTGAGCTCAAGGTAAAGGAGATTAAGAACGGCAGACTTGCTATGTTCTCTATGTTTGGATTCTTCGTTCAGGCCATTGTTACTGGA
AAGGGTCCATTGGAGAACCTTGCTGACCACCTTGCAGACCCTGTCAACAACAACGCTTGGGCTTACGCCACAAACTTTGTCCCTGGAAAA
TGA\
Edits in Original Sequence 
(5')XTTGCTGGTGGGCCTCTTGGTGAGGTTGTCGACCCAATATACCCCGGTGGCAGCTTTGACCCATTAGGTCTTGCTGATGATCCAGA
GGCATTTTCTGAGCTCAAGGTAAAGGAGATTAAGAACGGCAGACTTGCTATGTTCTCTATGTTTGGATTCTTCGTTCAGGCCATTGTTAC
TGGAAAGGGTCCATTGGAGAACCTTGCTGACCACCTTGCAGACCCTGTCAACAACAACGCTTGGGCTTACGCCACAAACTTTGTCCCTGG
AAAATGA\(3')AAATCATAACATAATTTTTAAAATTTGATTGTTGATGGCCTTGTAAAATTGTTGCGAGTTACTTGACAATAGAATGGA
TTTTTTTTCTTCAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan