ESTScan Details for Unigene SGN-U206076

Score 
499
Direction 
Forward
Predicted Peptide Sequence 
MADLLSNYSSKLEAVPPSHCLPLHERPVDPVEIVNTIPVIDLGKAKGDERPAVVQQLMKAFEEYGFFQIINHGVPEKLMEEAMKVYKEFF
SLPAEEKERYAKDAANNTATGAAKMYSSSAKHYDSEEHRYWRDVLEHSANLD
Predicted Coding Sequence 
ATGGCAGACCTCCTCTCCAACTATTCAAGCAAATTAGAAGCAGTTCCTCCAAGTCACTGCTTGCCATTGCACGAAAGACCAGTGGATCCA
GTTGAAATTGTGAACACTATTCCAGTAATTGATTTGGGAAAAGCTAAGGGGGATGAACGACCTGCTGTCGTTCAACAACTTATGAAAGCT
TTTGAAGAATATGGGTTTTTTCAGATAATCAATCATGGAGTACCCGAAAAATTGATGGAAGAGGCAATGAAAGTGTACAAGGAATTTTTC
AGTCTGCCAGCGGAAGAAAAAGAGAGATATGCAAAGGATGCAGCAAATAATACAGCAACAGGTGCAGCGAAAATGTACAGTAGCAGTGCC
AAGCATTATGATTCAGAGGAGCATCGATACTGGAGGGATGTGTTGGAACATAGCGCCAATCTTGAC\
Edits in Original Sequence 
TGTTTGTTTGATAGATTCAGCAACA(5')ATGGCAGACCTCCTCTCCAACTATTCAAGCAAATTAGAAGCAGTTCCTCCAAGTCACTGCT
TGCCATTGCACGAAAGACCAGTGGATCCAGTTGAAATTGTGAACACTATTCCAGTAATTGATTTGGGAAAAGCTAAGGGGGATGAACGAC
CTGCTGTCGTTCAACAACTTATGAAAGCTTTTGAAGAATATGGGTTTTTTCAGATAATCAATCATGGAGTACCCGAAAAATTGATGGAAG
AGGCAATGAAAGTGTACAAGGAATTTTTCAGTCTGCCAGCGGAAGAAAAAGAGAGATATGCAAAGGATGCAGCAAATAATACAGCAACAG
GTGCAGCGAAAATGTACAGTAGCAGTGCCAAGCATTATGATTCAGAGGAGCATCGATACTGGAGGGATGTGTTGGAACATAGCGCCAATC
TTGAC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan