ESTScan Details for Unigene SGN-U206082

Score 
336
Direction 
Forward
Predicted Peptide Sequence 
APVSDFNWNTELKVAFEDXNKSSSNMQTYLFLARTSIDKGGSSNQNLSFGPWAWPNKRIGIFQPRAKVSASAIGGGQQSHYSVLGVPHNA
SSVDIKKAYRLLALKYHPDVSKDSRADEVFKRX
Predicted Coding Sequence 
GCACCTGTTTCAGATTTCAACTGGAACACAGAACTCAAGGTAGCGTTTGAAGATXTAAACAAGAGCAGTTCAAACATGCAGACCTATCTC
TTTTTGGCTCGAACTTCAATTGATAAAGGTGGTAGCTCCAACCAGAACTTATCTTTTGGACCATGGGCATGGCCTAACAAGCGCATAGGT
ATTTTTCAGCCTCGTGCAAAGGTTTCTGCATCTGCTATTGGTGGTGGGCAGCAGAGCCACTATAGCGTGCTTGGTGTTCCACACAATGCT
TCTTCTGTTGATATAAAAAAGGCCTATCGTCTTCTTGCTCTCAAGTATCATCCTGATGTCAGCAAGGATTCAAGAGCCGATGAGGTTTTC
AAGAGAAXX\
Edits in Original Sequence 
(5')GCACCTGTTTCAGATTTCAACTGGtAACACAGAACTCAAGGTAGCGTTTGAAGATXTAAACAAGAGCAGTTCAAACATGCAGACCT
ATCTCTTTTTGGCTCGAACTTCAATTGATAAAGGTGGTAGCTCCAACCAGAACTTATCTTTTGGACCATGGGCATGGCCTAACAAGCGCA
TAGGTATTTTTCAGCCTCGTGCAAAGGTTTCTGCATCTGCTATTGGTGGTGGGCAGCAGAGCCACTATAGCGTGCTTGGTGTTCCACACA
ATGCTTCTTCTGTTGATATAAAAAAGGCCTATCGTCTTCTTGCTCTCAAGTATCATCCTGATGTCAGCAAGGATTCAAGAGCCGATGAGG
TTTTCAAGAGAAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan