ESTScan Details for Unigene SGN-U206164

Score 
181
Direction 
Reverse
Predicted Peptide Sequence 
ICIPLFIANVHHGIRLSLTFSSLVALLDQQLDAGYKIGYLVAWILAGRGGILLTLCLSFASWLCGKTSSSTVALVVIAVWVGSNVARYAP
FPQGAILTLLYMSIKLQVDVS
Predicted Coding Sequence 
ATCTGCATTCCTCTCTTTATTGCTAATGTACACCATGGTATTCGTCTATCTTTGACATTCAGTAGCCTTGTGGCCTTGCTAGATCAACAG
TTGGACGCTGGATACAAGATTGGTTACCTTGTTGCATGGATTTTGGCAGGTAGAGGTGGTATTCTACTCACATTATGTCTTTCATTTGCA
AGTTGGCTTTGTGGAAAAACGAGCAGTAGCACAGTCGCATTGGTGGTTATAGCCGTGTGGGTCGGATCTAATGTTGCTAGATATGCTCCA
TTTCCACAAGGTGCAATTCTTACACTGTTATACATGTCAATCAAGTTACAAGTTGATGTTAGCTAA\
Edits in Original Sequence 
(5')ATCTGCATTCCTCTCTTTATTGCTAATGTACACCATaGGTATTCGTCTATCTTTGACATTCAGTAGCCTTGTGGCCTTGCTAGATC
AACAGTTGGACGCTGGATACAAGATTGGTTACCTTGTTGCATGGATTTTGGCAGGTAGAGGTGGTATTCTACTCACATTATGTCTTTCAT
TTGCAAGTTGGCTTTGTGGAAAAACGAGCAGTAGCACAGTCGCATTGGTGGTTATAGCCGTGTGGGTCGGATCTAATGTTGCTAGATATG
CTCCATTTCCACAAGGTGCAATTCTTACACTGTTATACATGTCAATCAAGTTACAAGTTGATGTTAGCTAA\(3')AGCTTCTGCAACAG
AGTGATCACTTACTGAATGTGTCACTCTCTGTCTGTAAATTTGCTCCACTATAACTTCTAGTTATTTTTCTTATAGTCAATAATAGTTTC
TAAATGTAAATGCACAATCAAAACTTTTATATGTTCTACAACTTGTTCAAATACATCTTTAACCAGCAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan