ESTScan Details for Unigene SGN-U206273

Score 
278
Direction 
Forward
Predicted Peptide Sequence 
MSWINLLILLALCLFPLLGECRVRHYKFNVVMKNTTRLCSSKPIVTANGKFPGPQSMLGKETNALIKVVNHVKYNASIHWHGIRQLRTGW
ADGPAYINTIAQLSQGKIXVYNFTITGQRGTLSLGMLIILWLRATVHGAIAILPKWVALFFPKPNIKLLHPTDCGNPTEXVIMSLKSGCT
YVLRPR
Predicted Coding Sequence 
ATGTCTTGGATTAACCTTCTCATTCTATTGGCACTTTGTCTTTTTCCTCTTCTTGGTGAATGCAGAGTTAGACATTACAAATTCAATGTG
GTAATGAAAAACACAACTCGACTTTGTTCCTCAAAGCCCATTGTTACTGCTAATGGAAAATTTCCAGGACCACAGTCTATGCTAGGGAAG
GAGACAAATGCACTTATCAAAGTTGTTAATCATGTTAAGTATAATGCCTCTATCCATTGGCATGGTATTAGACAACTTAGAACAGGATGG
GCAGATGGACCAGCATATATTAACACAATTGCCCAACTTAGCCAGGGCAAAATTAXTGTGTACAACTTCACCATAACAGGCCAAAGGGGT
ACACTATCTCTTGGCATGCTCATCATTTTGTGGCTAAGGGCCACTGTCCATGGTGCAATTGCAATCTTGCCTAAATGGGTTGCCCTATTC
TTTCCCAAACCAAACATTAAGCTGTTGCATCCTACTGATTGTGGAAATCCAACTGAAGXTGTGATAATGAGCCTAAAATCAGGTTGCACC
TATGTTCTGCGCCCCCGX\
Edits in Original Sequence 
CTTTTTTCAAAAAAAAAAAAACAAAAGTG(5')ATGTCTTGGATTAACCTTCTCATTCTATTGGCACTTTGTCTTTTTCCTCTTCTTGGT
GAATGCAGAGTTAGACATTACAAATTCAATGTGGTAATGAAAAACACAACTCGACTTTGTTCCTCAAAGCCCATTGTTACTGCTAATGGA
AAATTTCCAGGACCtACAGTCTATGCTAGGGAAGGAGACAAATGCACTTATCAAAGTTGTTAATCATGTTAAGTATAATGCCTCTATCCA
TTGGCATGGTATTAGACAACTTAGAACAGGATGGGCAGATGGACCAGCATATATTAACACAATTGCCCAACTTAGCCAGGGCAAAATTAX
TGTGTACAACTTCACCATAACAGGCCAAAGGGGTACACTATCTCTTGGCATGCTCATCATTTTGTGGCTAAGGGCCACTGTCCATGGTGC
AATTGCAATCTTGCCTAAAcTGGGTTGCCCTATTCTTTCCCAAACCAAACATTAAGCTGTTGCATCCTACTGATTGTGGAAATCCgAACT
GAAGXTGTGATAATGAGCCTAAAATCAGGTTGCACCTATGTTCTGCGCCCCCGX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan