ESTScan Details for Unigene SGN-U206343

Score 
149
Direction 
Forward
Predicted Peptide Sequence 
KRRPNHHLPSSPLRLLLFATPEEAAAERRKRKRRLRIEPPLSSLRQQNQPRPTTPQNPSSTNNPNAPKIPETVSALSGNRLNLHNRILKL
IRENDLDEAALYTGTLFTPIAAPLSXTCNAVMAAQLRQSRYSDLLALHRFITQAGIGANIVTHNLLLTAFMDCRKTDMAMEHYKQLINNA
Predicted Coding Sequence 
AAGCGCCGCCCTAACCACCACCTTCCTTCATCTCCXCTCCGTCTCCTTTTATTTGCCACCCCAGAAGAGGCTGCCGCCGAACGCCGTAAA
CGCAAACGCCGACTCCGTATTGAACCCCCTTTATCCTCTCTTCGACAACAAAACCAACCTCGTCCCACTACACCTCAAAACCCTAGCTCC
ACTAATAACCCGAATGCACCGAAGATCCCGGAAACTGTTTCTGCACTATCCGGTAATAGACTTAATCTCCATAACCGGATTCTCAAGTTG
ATTCGCGAGAATGATTTGGATGAAGCTGCTTTGTACACCGGCACTCTGTTTACTCCAATTGCCGCCCCACTATCTTTXACTTGTAACGCT
GTTATGGCTGCGCAACTCCGACAGTCTCGTTATTCTGATCTACTTGCTCTTCACCGTTTCATCACGCAGGCTGGTATCGGGGCTAATATT
GTCACACATAATCTGCTCCTCACGGCTTTTATGGATTGCCGGAAAACGGATATGGCTATGGAACATTACAAGCAGCTCATCAATAATGCA
\
Edits in Original Sequence 
(5')AAGCGCCGCCCTAACCACCACCTTCCTTCATCTCCXCTCCGTCTCCTTTTATTTGCCACCCCAGAAGAGGCTGCCGCCGAACGCCG
TAAACGCAAACGCCGACTCCGTATTGAACCCCCTTTATCCTCTCTTCGACAACAAAACCAACCTCGTCCCACTACACCTCAAAACCCTAG
CTCCACTAATAACCCGAATGCACCGAAGATCCCGGAAACTGTTTCTGCACTATCCGGTAATAGACTTAATCTCCATAACCGGATTCTCAA
GTTGATTCGCGAGAATGATTTGGATGAAGCTGCTTTGTACACgCGGCACTCTGTTTACTCCAATTGCCGCCCCACTATCTTTXACTTGTA
ACGCTGTTATGGCTGCGCAACTCCGACAGTCTCGTTATTCTGATCTACTTGCTCTTCACCGTTTCATCACGCAGGCTGGTATCGGGGCTA
ATATTGTCACACATAATCTGCTCCTCACGGCTTTTATGGATTGCCGGAAAACGGATATGGCTATGGAACATTACAAGCAGCTCATCAATA
ATGCA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan