ESTScan Details for Unigene SGN-U206962

Score 
225
Direction 
Forward
Predicted Peptide Sequence 
SITKPLKCPSNQLPKLSFFKPNFPLKPISRNLSIRASVSTSEPQTQKFQHCFKKSEDGFLY
Predicted Coding Sequence 
XCATCAATTACTAAGCCCCTCAAATGCCCTTCAAACCAATTACCAAAGCTCTCATTTTTCAAACCCAATTTTCCATTGAAGCCCATTTCA
AGAAATCTAAGCATAAGGGCATCTGTGTCAACATCTGAGCCTCAAACTCAGAAATTTCAGCATTGTTTCAAGAAATCTGAAGATGGTTTT
TTGTATTGA\
Edits in Original Sequence 
(5')XCATCAATTACTAAGCCCCTCAAATGCCCTTCAAACCAATTACCAAAGCTCTCATTTTTCAAACCCAATTTTCCATTGAAGCCCAT
TTCAAGAAATCTAAGCATAAGGGCATCTGTGTCAACATCTGAGCCTCAAACTCAGAAATTTCAGCATTGTTTCAAGAAATCTGAAGATGG
TTTTTTGTATTGA\(3')GAGGGTGTTAAGGTTGAAGACGTTATGGAGACTGTGGAAAGACGACCTTTGTATCTATATAGTAAACCCCAA
CTCACTAGGAAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan