ESTScan Details for Unigene SGN-U206983

Score 
516
Direction 
Forward
Predicted Peptide Sequence 
MGKDSKSNDSGCKGKGKQAAGGKEDGASKGKGKAGKADGLGTCTYVKARHVLCEKQSKINEAYKILQEGWLNNGDKVPPAEFAKVAATYS
ECPSGKKGX
Predicted Coding Sequence 
ATGGGGAAGGACTCCAAGTCTAATGATTCTGGATGCAAGGGAAAGGGTAAACAGGCAGCTGGTGGAAAAGAGGATGGTGCTTCGAAAGGA
AAAGGAAAAGCTGGAAAAGCAGATGGTCTTGGAACCTGCACATATGTTAAAGCAAGACATGTCTTATGTGAGAAGCAGTCAAAGATTAAT
GAAGCATACAAAATACTGCAGGAAGGCTGGCTGAACAATGGAGATAAAGTTCCACCAGCTGAGTTTGCCAAGGTAGCTGCAACTTACTCA
GAATGCCCCTCAGGAAAGAAAGGGGXX\
Edits in Original Sequence 
AAGTT(5')ATGGGGAAGGACTCCAAGTCTAATGATTCTGGATGCAAGGGAAAGGGTAAACAGGCAGCTGGTGGAAAAGAGGATGGTGCT
TCGAAAGGAAAAGGAAAAGCTGGAAAAGCAGATGGTCTTGGAACCTGCACATATGTTAAAGCAAGACATGTCTTATGTGAGAAGCAGTCA
AAGATTAATGAAGCATACAAAATACTGCAGGAAGGCTGGCTGAACAATGGAGATAAAGTTCCACCAGCTGAGTTTGCCAAGGTAGCTGCA
ACTTACTCAGAATGCCCCTCAGGAAAGAAAGGGGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan