ESTScan Details for Unigene SGN-U206999

Score 
94
Direction 
Reverse
Predicted Peptide Sequence 
KNGLKIPVKVQPKEQNMAQNVGSMAVADGPTIPSGSTNLNGLSYLLVVGXINLLIGPLDENNNCGLPRLLFKRIRIMYHFIPPTNX
Predicted Coding Sequence 
AAAAATGGGCTGAAAATTCCTGTGAAAGTCCAGCCCAAAGAGCAAAACATGGCCCAAAATGTTGGATCAATGGCAGTAGCTGATGGGCCT
ACAATACCTTCTGGATCGACAAATTTAAATGGGCTTTCTTACCTTTTGGTTGTTGGGTTXATTAATCTACTTATTGGGCCTTTAGATGAA
AATAACAATTGTGGGTTGCCTAGACTCTTATTTAAGAGGATAAGGATAATGTACCACTTTATTCCACCTACTAATAAX\
Edits in Original Sequence 
(5')AAAAATGGGCTGAAAATTCCTGTGAAAGTCCAGCCCAAAGAGCAAAACATGGCCCAAAATGTTGGATCAATGGCAGTAGCTGATGG
GCCTACAATACCTTCTGGATCGACAAATTTAAATGGGCTTTCTTACCTTTTGGTTGTTGGGTTXATTAATCTACTTATTGGGCCTTTAGA
TGAAAATAACAATTGTGGGTTGCCTAGACTCTTATTTAAGtAGGATAAGGATAATGTACCACTTTATTCCACCTACTAATAAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan