ESTScan Details for Unigene SGN-U207046

Score 
266
Direction 
Forward
Predicted Peptide Sequence 
SGWKNILXCILSLHNFGLLPTRLFSDAADDXIVSSDADKSKPATVSPSAPHVPLLAPSRKSSGLMGRFSQLLYLDAEEPAPQPNEKQLAA
RQLTLQTIQKCHIDSIFAESKLLQAESLSX
Predicted Coding Sequence 
TCTGGTTGGAAAAACATCCTANACTGCATTTTGAGCTTGCATAACTTTGGCCTTCTTCCTACTCGTCTTTTTAGTGATGCTGCTGATGAT
GXTATAGTCTCTTCTGATGCTGACAAAAGCAAACCTGCTACAGTTTCCCCATCAGCACCTCATGTGCCTTTATTGGCGCCATCAAGGAAG
TCATCTGGCTTAATGGGCCGATTTAGTCAACTGTTATATCTTGATGCAGAGGAACCTGCACCTCAGCCAAATGAAAAACAGCTTGCCGCC
CGTCAGCTGACTCTTCAGACTATTCAGAAATGTCACATTGATAGCATCTTTGCTGAGAGTAAGCTTTTGCAAGCAGAGTCCCTTTCACXX
\
Edits in Original Sequence 
(5')TCTGGTTGGAAAAACATCCTANACTGCATTTTGAGCTTGCATAACTTTGGCCTTCTTCCTACTCGTCTTTTTAGTGATGCTGCTGA
TGATGXTATAGTCTaCTTCTGATGCTGACAAAAGCAAACCTGCTACAGTTTCCCCATCAGCACCTCATGTGCCTTTATTGGCGCCATCAA
GGAAGTCATCTGGCTTAATGGGCCGATTTAGTCAACTGTTATATCTTGATGCAGAGGAACCTGCACCTCAGCCAAATGAAAAACAGCTTG
CCGCCCGTCAGCTGACTCTTCAGACTATTCAGAAATGTCACATTGATAGCATCTTTGCTGAGAGTAAGCTTTTGCAAGCAGAGTCCCTTT
CACXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan