ESTScan Details for Unigene SGN-U207319

Score 
309
Direction 
Forward
Predicted Peptide Sequence 
MAESKDSHVIVEIPVDEEHQQKLSSAITTITAIQNHPLMEISRSPGHLLLLKLWQREEDLSGRRIAAKETRMDSIGEKYFRSVVSSLSFM
LCFLRFYSPPFRSTTVMIMLCVSNGGFLRFY
Predicted Coding Sequence 
ATGGCAGAATCAAAGGATTCCCATGTTATCGTCGAAATCCCCGTCGACGAAGAGCATCAGCAAAAGCTTTCTTCAGCCATTACTACTATA
ACTGCAATTCAAAACCACCCATTAATGGAAATCTCTAGAAGTCCAGGTCATCTCTTGCTTCTCAAGCTTTGGCAAAGAGAAGAGGATCTC
TCTGGCCGCAGAATTGCAGCCAAAGAGACACGAATGGACAGTATTGGAGAGAAATATTTCAGATCTGTTGTTTCTTCTTTATCTTTCATG
CTCTGTTTTTTACGATTCTATTCACCTCCGTTTCGGAGCACCACCGTGATGATAATGTTGTGTGTAAGCAATGGTGGATTCCTTCGATTC
TAT\
Edits in Original Sequence 
AAGCTTTCTTAATTCATCTTATTGTTAGTGTTTTGGTTTTGCTGTTCTATTAGCACTTGCTTCATTGCAGTTTTTAAATTTAAGAAAGTT
TCCATCA
(5')ATGGCAGAATCAAAGGATTCCCATGTTATCGTCGAAATCCCCGTCGACGAAGAGCATCAGCAAAAGCTTTCTTCAGCCA
TTACTACTATAACTGCAATTCAAAACCACCCATTAATGGAAATCTCTAGAAGTCCAGGTCATCTCTTGCTTCTCAAGCTTTGGCAAAGAG
AAGAGGATCTCTCTGGCCGCAGAATTGCAGCCAAAGAGACACGAATGGACAGTATTaGGAGAGAAATATTTCAGATCTGTTGTTTCTTCT
TTATCTTTCATGCTCTGTTTTTTACGATTCTATTCACCTCCGTTTCGGAGCACCACCGTGATGATAATGTTGTGTGTAAGCAATGGTGGA
TTCCTTCGATTCTAT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan