ESTScan Details for Unigene SGN-U207520

Score 
219
Direction 
Forward
Predicted Peptide Sequence 
VYALSIGFLLLTIERRRDTGHILDIPLPKEDISSPKGFKYIWYALSGYSIGLVTALAAGXFDSLASTSSSILGTINFGTDNVISWMRKEL
AELWEGSPSNINEKTHLTEADLLHSSAXKASAKLGVLKHVNLLGXSSAPSIGHLKFVEHFSKVVTFKVSGILTRVPNEVLRQ
Predicted Coding Sequence 
XCCGTCTATGCTCTTAGCATTGGTTTTCTGCTTTTGACCATAGAAAGACGCAGGGACACTGGACACATCTTGGATATACCACTTCCAAAG
GAGGATATATCATCTCCAAAGGGGTTTAAGTACATATGGTATGCCCTATCAGGATATTCAATCGGACTGGTAACTGCTTTAGCAGCTGGT
XATTTTGACTCACTCGCCTCAACCAGCTCTTCTATACTTGGTACCATCAACTTTGGGACCGATAATGTCATTTCATGGATGAGAAAAGAG
CTAGCAGAGTTGTGGGAAGGATCACCATCAAACATCAATGAGAAAACTCATCTTACAGAAGCTGATCTCTTGCATTCCTCTGCAXTGAAG
GCGTCAGCTAAGCTGGGCGTGTTGAAACATGTAAATTTACTTGGAAXTAGTTCAGCTCCATCTATTGGACACTTAAAATTTGTTGAACAT
TTCAGCAAGGTTGTCACTTTTAAGGTCTCGGGGATACTTACAAGGGTGCCAAATGAGGTCTTGAGACAGTGA\
Edits in Original Sequence 
(5')XCCGTCTATGCTCTTAGCATTGGTTTTCTGCTTTTGACCATAGAAAGACGCAGGGACACTGGACACATCTTGGATATACCACTTCC
AAAGGAGGATATATCATCTCCAAAGGGGTTTAAGTACATATGGTATGCCCTATCAGGATATTCAATCGGACTGGTAACTGCTTTAGCAGC
TGGTXATTTTGACTCACTCGCCTCAACCAGCTCTTCTATACTTGGTACCATCAACTTTGGGACCGATAATGTCATTTCATGGATGAGAAA
AGAGCTAGCAGAGTTGTGGGAAGGATCACCATCAAACATCAATGAGAAAACTCATCTTACAGAAGtCTGATCTCTTGCATTCCTCTGCAX
TGAAGGCGTCAGCTAAGCTGGGCGTGTTGAAACATGTAAATTTACTTGGAAXTAGTTCAGCTCCATCTATTGGACACTTAAAATTTGTTG
AACATTTaCAGCAAGGTTGTCACTTTTAAGGTCTCGGGGATACTTACAAGGGTGCCAAATGAGGTCTTGAGACAGTGA\(3')CGAACCT
CGGACTTATTATATTTTAATTACAAATGCTAATATTTTGTATTAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan